(data stored in ACNUC29543 zone)

EMBL: CT978603.PE697

CT978603.PE697       Location/Qualifiers
FT   CDS_pept        complement(630518..630760)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0697"
FT                   /locus_tag="SynRCC307_0697"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0697"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27600"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU1"
FT                   /protein_id="CAK27600.1"
FT                   /translation="MTKWLRTPDAVEALGVSADFLKRHRDSHGGFFEEGKHYVLGASLN
FT                   ASIRWNVDECRDRIHHHGRLAREAHRQLNQLKEGN"
     atgaccaaat ggcttcgcac acctgatgcg gttgaagctc tgggcgtatc ggctgacttc        60
     ctcaagcggc accgtgactc ccatggcggc ttctttgaag agggcaagca ctatgtcctc       120
     ggcgcatctc tcaacgcgtc aattcgatgg aacgtcgatg aatgtcgtga tcggatccac       180
     caccacgggc gcctagcgcg tgaggctcat cggcagttga accagctgaa ggagggcaac       240
     tga                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page