(data stored in ACNUC29543 zone)

EMBL: CT978603.PE698

CT978603.PE698       Location/Qualifiers
FT   CDS_pept        complement(630735..631052)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0698"
FT                   /locus_tag="SynRCC307_0698"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27601"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRU2"
FT                   /protein_id="CAK27601.1"
FT                   /translation="MVGHRIEGEAVFVHVSAMAKKQNRFANRAGQTRRINGRHVHAKKD
FT                   ENLRIAFAVIEKALRDHPDADLEWFEKVCGDCEGLEDVLKLVRAGALNNFRTNDQMASH
FT                   T"
     atggtgggac atcggattga gggggaagcg gtttttgttc acgtctcggc aatggccaag        60
     aagcagaacc gtttcgccaa tagggcaggg cagacccgtc gcatcaacgg caggcatgtt       120
     catgccaaaa aagacgaaaa tttacgaatt gcatttgcag tcatcgagaa ggccctgagg       180
     gatcaccctg atgcagatct ggagtggttt gaaaaggtct gtggtgactg tgaaggtctc       240
     gaagatgttc tgaagttggt cagagcaggg gcactcaata acttccgtac caatgaccaa       300
     atggcttcgc acacctga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page