(data stored in ACNUC29543 zone)

EMBL: CT978603.PE717

CT978603.PE717       Location/Qualifiers
FT   CDS_pept        complement(647753..647944)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0717"
FT                   /locus_tag="SynRCC307_0717"
FT                   /product="Uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0717"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27620"
FT                   /db_xref="GOA:A5GRW1"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW1"
FT                   /protein_id="CAK27620.1"
FT                   /translation="MGQRLGSVLPIVVIGIVADLAVQILLDVEVVLALWGVGSGVRHRI
FT                   DPSQVMLLGVPQLSGAAS"
     gtggggcagc ggctcggttc cgtactccca atcgtcgtaa tcgggatcgt tgcggatctt        60
     gcggtgcaga tccttttgga tgtcgaagtc gtgttggcgc tctggggcgt tggatccgga       120
     gtcaggcatc ggatcgatcc ctcgcaggtg atgttgcttg gtgtaccaca gctgagcggc       180
     gctgccagct ga                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page