(data stored in ACNUC29543 zone)

EMBL: CT978603.PE720

CT978603.PE720       Location/Qualifiers
FT   CDS_pept        complement(650707..651726)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0720"
FT                   /locus_tag="SynRCC307_0720"
FT                   /product="Putative ABC transporter, oligopeptides, permease
FT                   component"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0720"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27623"
FT                   /db_xref="GOA:A5GRW4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW4"
FT                   /protein_id="CAK27623.1"
FT                   /translation="MSNSSSLVRYLGSRLLLAPVMLWLIASLVFLLLRVAPGDPVDALL
FT                   GNRASAAARDQLRAQLGLDQSLWDQYREFLGALLQGDLGTSLRNSTPVGEIVRDALPAS
FT                   LELGITALLVALVVGLAVGFSGVARPEGKLDLSGRLYGIGTYALPVFWAAMVMQLIFAV
FT                   GLGWFPVGGRFPPTALPPQGTGFYLLDGILQANPQVIWGTLQHLALPAITLGLLLSGIF
FT                   ERALRLNLRRALRSDYVEAARSRGISERRVVLRHALPNALLPVLTITGITVASLIGGAL
FT                   LIELIFSWPGIAYRLQEAIAQRDYPLVQGIVVVIAALVVMVNLAVDVVVALLDPRLKF"
     atgagcaaca gcagttcgct ggttcgctat ctgggcagtc gcctgctgct ggcgcctgtg        60
     atgctgtggc tgatcgcctc gctggtgttt ctgctgctgc gcgtggcccc aggggatccc       120
     gtcgacgcgc tgctgggcaa ccgggccagc gcagcggccc gggaccagct gcgggcccaa       180
     ctggggctcg accaatccct atgggatcaa taccgcgagt ttttaggagc cttgctgcaa       240
     ggggatctgg gcacctccct gcggaattcc acgcccgtgg gagagatcgt gcgcgacgcc       300
     ctaccagcca gccttgagct cggcatcacg gccttgctgg tggccctggt ggtgggctta       360
     gccgtgggct tcagcggtgt agcgcggccg gagggaaaac tcgatctcag cggccggctc       420
     tatggcatcg gcacctatgc cttgccggtg ttttgggccg ccatggtgat gcaactgatc       480
     tttgccgttg gcctgggttg gtttccggtc ggtggcaggt ttccgcccac cgccttaccg       540
     ccccagggga ccggctttta tctgctcgat ggaatcctgc aggccaatcc ccaggtgatt       600
     tggggcacgt tgcagcattt agccctgcca gccatcacct tgggactgct gctcagcggg       660
     atctttgaac gggccttgcg gctcaacctg cggcgcgccc tgcgctcgga ttacgtcgaa       720
     gccgccagga gccggggcat tagtgagcgg cgcgtggtgc tgcgtcacgc attacccaat       780
     gccctgctgc cggtgctgac gatcaccggc atcaccgtgg cctcactgat cggcggagcg       840
     ttgttgattg agttgatctt ttcctggcct ggcattgcct accggctcca ggaagccatt       900
     gcccaacggg actaccccct ggtgcaaggg attgtggtgg tgatcgccgc tttggtggtg       960
     atggtgaatc tggcggtgga tgtggtggtg gcgctgctgg atccgcggct gaagttttaa      1020
//

If you have problems or comments...

PBIL Back to PBIL home page