(data stored in ACNUC29543 zone)

EMBL: CT978603.PE721

CT978603.PE721       Location/Qualifiers
FT   CDS_pept        complement(651723..653324)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0721"
FT                   /locus_tag="SynRCC307_0721"
FT                   /product="ABC-type oligopeptide transport system
FT                   periplasmic component"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27624"
FT                   /db_xref="GOA:A5GRW5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW5"
FT                   /protein_id="CAK27624.1"
FT                   /translation="MLLARANLKQRGKRAAGLLLASLMLLAGCRPPTASDRAPLVIAAY
FT                   GSIDSVDPAQATTVIALQLISALGDPLYAIDGQGAIQPKLARALPRLSDDGLTATIPLR
FT                   QGVLFHDGTPFDADAMAFSLRRFLAIGKLSYVVGDRISAVRVTGPYELQLDLRRPFSPL
FT                   AKLLSFASLTPISPTAYANYEAGFRPNAFVGTGPYELRLQSPQLQRLEPFAQYWGEAPR
FT                   NDGIALVGMSTSTSLYGAISSGNVDVLLSTSLEPEQQSALHQQANQGQLREGAGPALGI
FT                   GYITLLTDRPPLDNQTLRRALAFSLDRELLTKRVTDKLRPPLRGLVPPKLPGALAAWPR
FT                   ADASRARQLLQQEGYCSGEVLPLQLTYRSNVPTDRLLALSWQEWLRSRLGDCVRLDLTG
FT                   MESTTAYRQLGDGAFQMILLDWMGDYPDADNYLTPLLGCTQSEGNRCLEGDSASGGSFW
FT                   TAPGLEEKLRLSNERRGQARLDLLDAVQREAANGVPYLPMWQTRPRAWARNSITAPQFD
FT                   GSGRLNFASLSRRSLP"
     ttgctgctgg cacgtgcgaa tttgaagcaa cggggcaagc gagcagcagg gcttttgtta        60
     gccagcctga tgctgttggc gggctgccgg ccgccaacag catccgatcg agccccgctg       120
     gtgatcgcgg cctatggctc catcgacagc gtcgatccag cccaagccac cacggtgatc       180
     gcgctgcagc tgatcagcgc cttaggggat ccgctttatg ccattgatgg gcaaggcgcg       240
     atccagccca aattggcccg tgcgctgccc aggctcagcg acgacggact caccgccacc       300
     attcccttaa ggcagggggt gctcttccac gacggcaccc cctttgatgc ggacgccatg       360
     gccttcagcc tgcggcgctt tctggccatt gggaaactca gctacgtggt gggcgaccgc       420
     atcagcgcgg ttcgggtgac agggccctac gagctgcagc tggacttgcg ccgccccttt       480
     agccccctgg ccaagctgct gagcttcgcc agcctcacgc cgatctcacc aacggcctac       540
     gccaactacg aagccggttt ccggcccaac gcctttgtgg gcacagggcc ctacgaattg       600
     cgcttgcaaa gcccgcaatt gcaacggctg gaaccgtttg cgcagtactg gggcgaggcc       660
     cctcgcaacg acggcatcgc cctagtgggc atgagcacct caacaagcct ctacggggcc       720
     atcagcagcg gcaatgtcga tgtgttgctc tccaccagcc tggagcccga gcagcagagc       780
     gctctgcatc aacaggccaa ccaaggccag ttgcgcgaag gggccgggcc agcactcggc       840
     attggctaca tcacgctgct gaccgatcgc ccaccactcg ataaccaaac gttgcggcgg       900
     gcgttggcct tcagcctcga ccgcgagctg ctgaccaagc gggtcaccga caagctccgc       960
     ccgccgctgc ggggcttggt gccgccgaaa ttgccaggag ctctggcggc ctggccgaga      1020
     gccgatgcca gccgtgctcg ccaactgctg cagcaagagg gctactgctc tggcgaggtg      1080
     ctgccgctgc agctcaccta ccgctccaac gtgcccaccg accgcttgct ggccttgagc      1140
     tggcaggagt ggttgcgcag ccggctagga gactgcgtgc ggcttgatct cacaggcatg      1200
     gaatccacca ccgcataccg ccaactgggt gatggggcct tccaaatgat tctgctcgat      1260
     tggatgggcg actatcccga tgccgacaac tacctgacgc cgctgctggg ctgcactcaa      1320
     tcagaaggca atcgctgctt ggagggcgat agcgcctccg gcggcagctt ctggacggcc      1380
     ccaggactgg aggaaaaact gcgcctcagc aatgaacgcc gcggccaagc ccgcctggac      1440
     ttgctcgatg ccgtgcagcg ggaggcagcc aatggggtcc cctatctacc gatgtggcaa      1500
     accaggccca gagcttgggc ccgcaacagc atcactgccc cccaattcga tggctcaggg      1560
     cgtttgaact tcgccagcct cagccgccgg tctttgccat ga                         1602
//

If you have problems or comments...

PBIL Back to PBIL home page