(data stored in ACNUC29543 zone)

EMBL: CT978603.PE725

CT978603.PE725       Location/Qualifiers
FT   CDS_pept        complement(655383..655823)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0725"
FT                   /locus_tag="SynRCC307_0725"
FT                   /product="Uncharacterized conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0725"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27628"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRW9"
FT                   /protein_id="CAK27628.1"
FT                   /translation="MLRTFSFTALVAIALMNPARGLAHAVQTDVSSLLPSGSIKLRTSF
FT                   SSGEPLAHAPVRLESHDGDRSIELGATDADGRFTGELPALDSDAWDVVIDGGIGHRDYL
FT                   GLDERWPSSEALMGWLRNGGLLGATLALTGISLCHGQRQRRP"
     atgcttcgaa ccttcagctt tacggcccta gtggcgatcg ctctgatgaa tcctgcgcgc        60
     ggcttagccc acgccgtcca gaccgatgtc agcagcctgc tgcccagtgg atcgatcaag       120
     ctgcgcacca gtttttccag tggtgaacca ctcgcccatg ccccagtgcg actggagtcc       180
     catgacggcg accgcagcat cgagctcggt gcaaccgatg ctgatggccg cttcacaggc       240
     gagctgccag cgctcgattc cgacgcttgg gatgtggtga ttgatggcgg catcggccac       300
     cgcgactacc tcggcctcga tgaacgctgg ccatccagcg aggcgctgat gggctggctc       360
     cgcaacggcg gcctgcttgg cgccacactg gccttgaccg gtatcagcct ttgccatggc       420
     cagcggcagc gccgcccttg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page