(data stored in ACNUC29543 zone)

EMBL: CT978603.PE73

CT978603.PE73        Location/Qualifiers
FT   CDS_pept        69729..70595
FT                   /transl_table=11
FT                   /gene="SynRCC307_0073"
FT                   /locus_tag="SynRCC307_0073"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26976"
FT                   /db_xref="InterPro:IPR007570"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ17"
FT                   /protein_id="CAK26976.1"
FT                   /translation="MGQQAWIIQQELVQPVVPAAPGLLARWEDGSHPMPLGMSPAASLP
FT                   TSLQRALEQRRLLKVIAGLANFDSASVARVARAAAAGGADLVDVACDPELVALAAAESG
FT                   LPICVSAVDPELFPAAVAAGAAMVEIGNYDSFYPQGRLFDAAEVLELTRRTRQLLSEVT
FT                   LSVTVPHTLPLDQQEQLAIDLVDAGADWIQTEGGTSANPLSPGVQGLIEKASPTLAAAH
FT                   VISRAVAVPVLCASGLSAVTLPLAQAAGAAGVGVGSAINRLSDELAMVAVVRGLRDALS
FT                   ALNPVQV"
     ttggggcagc aggcttggat catccagcag gagctggtgc agcctgtggt gccagcggct        60
     ccagggttgc ttgccagatg ggaggatggt tctcatccga tgccgttggg tatgtcccct       120
     gctgccagcc tgccaacttc cttgcagcgt gcacttgagc aacgtcgtct gctcaaggtg       180
     atcgccggtc tcgccaactt cgactctgca tccgtggcgc gcgtggcacg ggccgccgcc       240
     gctggtggtg ctgatttggt ggatgtggcc tgcgaccccg agctggtggc gttagctgcg       300
     gctgaatccg gtctgccgat ctgcgtgtca gctgtggatc ctgaactgtt tcccgcggct       360
     gttgctgctg gtgccgccat ggtggagatc ggcaactacg acagctttta tcctcagggc       420
     cgcctgtttg atgctgccga ggtgttggaa ctcacccgcc gcacccgtca gctgctatct       480
     gaggtcaccc tgtcggtgac ggtgccccac accctgcccc tggatcagca agagcaactg       540
     gccattgacc tggtggatgc tggcgctgat tggattcaga ccgaaggcgg caccagtgcc       600
     aaccccctca gcccaggggt tcagggcctg attgaaaagg cgtcaccaac cttggctgcc       660
     gctcatgtga tcagccgggc tgttgccgtg ccggtgctct gcgcttctgg tctgtcggcg       720
     gtgaccctgc cgttggctca ggccgctgga gcggctggtg tgggggtggg ctctgccatc       780
     aaccgcctta gcgatgagct cgccatggtg gcggtggtgc gcggtctgcg tgatgctctg       840
     tccgctctga accctgtgca ggtctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page