(data stored in ACNUC29543 zone)

EMBL: CT978603.PE88

CT978603.PE88        Location/Qualifiers
FT   CDS_pept        complement(87193..88293)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0088"
FT                   /locus_tag="SynRCC307_0088"
FT                   /product="cyanobacteria-specific GntR-like HTH domain
FT                   containing transcriptional regulator"
FT                   /note="Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26991"
FT                   /db_xref="GOA:A5GQ32"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ32"
FT                   /protein_id="CAK26991.1"
FT                   /translation="MAKPTQRTRQELSRGTCATTVARSICCHTPGVRFHIQQESDIPAS
FT                   TQLYNQICFAIAARHFPPGHRLPSTRQLAMQTGLHRNTISKVYRQLENDGVVEAMAGSG
FT                   IYVRDQQKPREVKAPSGPRHRIRPDIDQEVRRSIDGLLNAGCTLQQARELLTREIDWRL
FT                   RCGARVLVSTPREDLGASLLIAEELTPKLEVPVEVVPLEELEAVLESSNNGTVVTSRYF
FT                   LQPVEELAKQHGVRAVAVDLNDFRHELAMLKELRAGSCVGLVSISPGILRAAEVILHSM
FT                   RGQELLVMTASPDVGSRLLALCRAASHVLCDRPSLPLVEQTLRQNRSQLMRLPQVHCAQ
FT                   SYLGASTIDMLCKEIGLDSSANAPSP"
     atggccaagc ccacacagag gacacgccag gaattgtcac gcgggacatg tgccactacg        60
     gtggcacggt cgatctgctg tcacacccca ggcgtgcgtt ttcatatcca acaggagagc       120
     gacattcccg cgtcgaccca gctctacaac cagatctgtt tcgcgatcgc ggcgcgtcac       180
     tttccaccgg gtcaccggct gcccagcacc cgccaactgg cgatgcaaac gggcctgcac       240
     cgcaacacca tcagcaaggt ctaccgccag ctggaaaacg atggtgtggt cgaagccatg       300
     gccggctcag gcatctatgt gcgcgaccag caaaaacccc gggaagtcaa agcacccagc       360
     ggcccgcgcc atcgcatccg gccggacatt gatcaggagg tgcgccgcag catcgatgga       420
     ctgctcaatg ccggctgcac gctgcagcag gcccgtgaac tgctgactcg agaaatcgac       480
     tggcgcctgc gctgcggtgc ccgcgtcttg gtgagcaccc cgcgcgagga cctgggcgcc       540
     tcgctgctga ttgccgaaga actcaccccc aaacttgagg tgccggtgga ggtggtgccc       600
     ctcgaagaac tggaagccgt gctggaaagc tccaacaacg gcaccgtcgt aaccagccgc       660
     tatttcctgc agcccgttga ggagctagcc aaacaacacg gcgtacgtgc tgtggctgtt       720
     gacctcaacg acttccgcca cgagctggcc atgctcaagg aattgcgcgc cggcagttgt       780
     gttggcctgg tgagcatcag cccgggcatc ctgcgggccg ctgaggtgat cctgcactcg       840
     atgcgcggcc aagagctgct tgtgatgacc gcgtcaccgg atgtgggcag ccgcttgctg       900
     gccctgtgcc gagcagccag ccacgtgctc tgcgaccgtc ccagcctgcc gctggtggag       960
     cagaccttgc ggcaaaatcg ctcgcaactg atgcgtctgc cgcaggtgca ctgcgcccag      1020
     agttatctcg gggccagcac gatcgacatg ctctgcaagg agatcggcct cgatagcagc      1080
     gccaacgccc ctagcccctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page