(data stored in ACNUC29543 zone)

EMBL: CT978603.PE9

CT978603.PE9         Location/Qualifiers
FT   CDS_pept        11034..11777
FT                   /transl_table=11
FT                   /gene="SynRCC307_0009"
FT                   /locus_tag="SynRCC307_0009"
FT                   /product="Uncharacterized conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26912"
FT                   /db_xref="GOA:A5GPV3"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV3"
FT                   /protein_id="CAK26912.1"
FT                   /translation="MVQSRSRSEPPVNVRLQQDLKNDLIAGLLVVIPLATTIWLATLVT
FT                   RFVVSFLTSVPKQFNPFNTLNPLLQELINLSVGLLVPLLGILLIGLMARNIVGRWLLDF
FT                   GEGTLARIPLAGSVYKTLKQILETVLRDNSTRFRRVVLIEYPRDGIYALGFVTGMLSAG
FT                   MQAGFPQPMISVFIPTAPNPTTGWYSIVPEASVKDLDMSVEEAFRTIISAGIVNPDEQP
FT                   SPSNRSFSSLLAQLRPTPLSAPPKA"
     ttggttcagt cccgttctcg atctgaaccg ccggtcaacg tgcggttgca gcaggatctg        60
     aaaaacgatc tgatcgccgg cttgctggtg gtcattccgt tggccaccac catctggttg       120
     gccaccttgg tcacccgttt cgtggtcagt tttctgacct cggttccaaa gcagttcaac       180
     ccgttcaaca ccctcaaccc gttgttgcag gagttgatca acctgtcggt ggggctgctg       240
     gtccccctgc tgggaatcct gttgatcggc ttgatggccc gcaacatcgt tggccgttgg       300
     ttgttggact tcggtgaggg caccctcgcc cgaatccctt tggctggatc ggtttacaag       360
     accctcaagc agattctgga aactgtgctg cgcgacaaca gcacacggtt tcggcgcgtt       420
     gtcttgatcg agtatccccg cgacgggatt tatgcccttg gctttgtcac cggcatgctc       480
     agcgccggca tgcaggctgg gttcccccaa ccgatgatca gcgtctttat ccccacagct       540
     ccgaacccca ccaccggttg gtacagcatc gttccagagg cttccgtgaa ggacctggac       600
     atgagcgtgg aagaggcctt ccgcacaatt atttccgctg gcatcgtcaa ccccgacgag       660
     cagcccagcc ccagcaatcg cagcttctcg agcctgctcg ctcaactgcg gcccacacct       720
     ctttcggctc ctcccaaagc ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page