(data stored in ACNUC29543 zone)

EMBL: CT978603.PE95

CT978603.PE95        Location/Qualifiers
FT   CDS_pept        93435..93848
FT                   /transl_table=11
FT                   /gene="SynRCC307_0095"
FT                   /locus_tag="SynRCC307_0095"
FT                   /product="Integral membrane protein possibly involved in
FT                   chromosome condensation"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26998"
FT                   /db_xref="GOA:A5GQ39"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ39"
FT                   /protein_id="CAK26998.1"
FT                   /translation="MAESQAQDSPNLDWRLLELILVAIGAVPGALIRWQAAGVYFGDGD
FT                   NVVVNVAGAFILGLLVGRGVDARWQLLVGTGFCGSLTTFSAWMVDCVVLMAAGQWLQAA
FT                   GLLGITLGLGLGFGALGVLLGRLLRRPRPSQSP"
     atggctgagt ctcaggctca ggacagcccg aatttggatt ggcgcctgtt ggagctgatc        60
     ctggtagcga ttggtgctgt acccggtgcc ttgatccgct ggcaagccgc tggggtgtat       120
     ttcggcgatg gcgacaacgt cgtcgtcaac gtggctgggg ctttcatttt gggcctgctg       180
     gttggccgcg gcgttgatgc ccgctggcag ctgctggtgg gcacagggtt ctgcggttcg       240
     ctcaccacct tcagcgcctg gatggtggat tgcgtggtgt tgatggccgc tggccagtgg       300
     ctccaggccg cagggttgct tggtatcacc ctgggcctgg gattgggatt tggagctctc       360
     ggcgtgttgc tcggccggct gctcaggcgg ccaaggccgt ctcaatcgcc gtag             414
//

If you have problems or comments...

PBIL Back to PBIL home page