(data stored in ACNUC29543 zone)

EMBL: CT978603.PE96

CT978603.PE96        Location/Qualifiers
FT   CDS_pept        complement(93817..94287)
FT                   /transl_table=11
FT                   /gene="SynRCC307_0096"
FT                   /locus_tag="SynRCC307_0096"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="Posttranslational modification, protein turnover,
FT                   chaperones"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26999"
FT                   /db_xref="GOA:A5GQ40"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ40"
FT                   /protein_id="CAK26999.1"
FT                   /translation="MALSLNGVSVTSADGSSRDLATDNGSVLLIVNVASQCGFTKQYAG
FT                   LQQLHERYGKQGLKVIGFPCNDFGAQEPGTIEEIKTFCSSNYGVSFELMSKVASDAAPF
FT                   DTLTQADPAGPIAWNFEKFLVGKDGGVIARFKSGVEPESSELTTAIETALAA"
     atggccctca gcctcaacgg cgtcagcgtg acctcagccg atggatccag ccgtgatctg        60
     gccaccgaca acggcagcgt cctgctgatc gtgaatgtgg ccagccagtg cgggttcacc       120
     aagcaatacg ccggactgca acagctccat gagcgctacg gcaagcaggg cctcaaggtg       180
     attggcttcc cttgcaatga ctttggcgcc caagagcccg gcacgatcga agagatcaaa       240
     accttctgct ccagcaacta cggcgtcagc tttgagctga tgagcaaggt ggcctctgac       300
     gctgccccct ttgacaccct gactcaagcc gaccccgctg gcccgatcgc ctggaatttc       360
     gagaaattcc tggtgggcaa agacggaggg gtgatcgccc gctttaaaag cggcgttgag       420
     ccggagagca gtgagctgac tacggcgatt gagacggcct tggccgcctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page