(data stored in ACNUC29543 zone)

EMBL: CT978603.PETC

CT978603.PETC        Location/Qualifiers
FT   CDS_pept        complement(637070..637606)
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="SynRCC307_0704"
FT                   /product="Cytochrome B6-F complex iron-sulfur subunit"
FT                   /EC_number="1.10.99.1"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0704"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27607"
FT                   /db_xref="GOA:A5GRU8"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GRU8"
FT                   /protein_id="CAK27607.1"
FT                   /translation="MTQISAKDVPGMGRRQFMNLLTFGSVTGVALGALYPVVNYFIPPK
FT                   ASGAGGGTTAKDELGNDVTASGWLADHKEGDRSLVQGLKGDPTYLIVDGPDSIGDYGIN
FT                   AICTHLGCVVPWNAGANKFMCPCHGSQYDATGKVVRGPAPLSLALAHVNVENDNVFVSQ
FT                   WSETDFRTDEKPWWA"
     atgacccaga tttcggcgaa ggacgttccc gggatgggcc gtcggcagtt catgaatctg        60
     ctgacctttg gatcggtcac cggggtggct ctgggcgccc tctacccggt ggtgaactac       120
     ttcattcctc ccaaggcttc tggcgccggt ggcggcacca ccgccaagga cgaactgggc       180
     aatgacgtca ccgccagcgg ctggctcgcc gatcacaagg aaggtgatcg cagcttggtt       240
     caaggcctca aaggtgaccc cacctacctg atcgttgatg gccccgattc catcggcgac       300
     tacggcatca atgccatctg cacccacctg ggttgcgtgg tgccctggaa tgccggcgcc       360
     aacaaattca tgtgcccctg ccacggctcc cagtacgacg ccaccggcaa ggtggtgcgc       420
     ggccccgctc ccctctcgct ggccttagcc cacgtgaacg tggagaacga caacgtcttc       480
     gtcagccagt ggtctgaaac cgacttccgc accgacgaga agccctggtg ggcttga          537
//

If you have problems or comments...

PBIL Back to PBIL home page