(data stored in ACNUC29543 zone)

EMBL: CT978603.PILT

CT978603.PILT        Location/Qualifiers
FT   CDS_pept        complement(21431..22576)
FT                   /transl_table=11
FT                   /gene="pilT"
FT                   /locus_tag="SynRCC307_0019"
FT                   /product="Tfp pilus assembly protein, pilus retraction
FT                   ATPase PilT"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26922"
FT                   /db_xref="GOA:A5GPW3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPW3"
FT                   /protein_id="CAK26922.1"
FT                   /translation="MAGLPLLPNSQGHTAEIGAPERAMELQIETLMEQLVEKGGSDLHL
FT                   SAGLPPYGRFSGALKPMHEAPLAEESCNRLIFSLLNNNQRKQLEQNWELDCSYGLKGVA
FT                   RFRVNVYREKGCYAACLRALGSSIPSLQQLGLPDVVREISERPRGLVLVTGPTGSGKTT
FT                   TLAALLNHINQQRAEHILTVEDPIEFVYKSERSVIHQRELGEDTRSFANALKAALREDP
FT                   DVILVGELRDLETIQLAITAAETGHLVFGTLHTSSAAQTVDRMVDVFPPEQQTQIRVQL
FT                   SGSLVAVFAQTLCRRLNPPPGAFGRVMAQEIMVNTPALANLIREGKTAQIYSQLQTGGQ
FT                   YGMQTLERALANLVDGGQVERGEALSKASKPDELMRLLGEA"
     atggctggat tgcccctatt gcctaactcc caggggcaca ctgcagagat aggggcacca        60
     gagcgagcca tggagctgca gatcgaaacc ctgatggagc aattggtgga gaaagggggc       120
     agcgatctgc acctttccgc cggattgccg ccttatggcc gcttcagtgg tgccttgaag       180
     cccatgcatg aggcgccgct ggccgaggaa agctgcaacc gcttgatctt cagcctgctc       240
     aacaacaacc agcgcaagca gctggagcag aactgggagc tggactgctc ctacgggctc       300
     aaaggcgtag cccgctttcg ggtcaacgtc taccgggaaa agggttgcta tgccgcctgc       360
     ctgcgggccc tgggcagcag catccccagc cttcagcaac tcggcctgcc tgatgtcgtg       420
     cgcgagatca gcgagcggcc gcgggggttg gtgctggtga ccgggcccac cggctcaggc       480
     aaaaccacca ccctggcggc gctgctaaac cacatcaacc aacagcgggc cgaacacatc       540
     ctcacggtgg aagacccgat tgagtttgtg tacaagtcag agcgcagcgt gattcaccag       600
     cgtgagctcg gtgaagacac ccgcagcttt gccaatgccc ttaaggccgc cctgcgggaa       660
     gacccggacg tgatcctggt gggggaactg cgtgatctgg aaaccatcca gctcgccatc       720
     accgccgcag aaacaggcca tttggtgttt ggcaccctgc acaccagctc agcagcgcaa       780
     acggtggatc gcatggtgga tgtgtttccg ccggagcaac aaacccagat ccgcgtgcaa       840
     ctcagcggca gcctggtggc cgtgtttgct caaaccctct gccgccggct caatccacct       900
     cccggcgcct ttggccgcgt gatggcccaa gaaatcatgg tcaacacccc ggccctggcg       960
     aacttgattc gcgaaggcaa aacagcccag atctattcgc agctgcaaac cggcggccaa      1020
     tacggcatgc aaaccctcga gcgcgccctg gccaacctgg tggatggcgg ccaagtggag      1080
     cggggtgaag ccttgagcaa agccagcaaa cccgatgaac taatgcggtt gctcggtgag      1140
     gcgtga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page