(data stored in ACNUC29543 zone)

EMBL: CT978603.PNTAB

CT978603.PNTAB       Location/Qualifiers
FT   CDS_pept        complement(345760..346080)
FT                   /transl_table=11
FT                   /gene="pntAB"
FT                   /locus_tag="SynRCC307_0359"
FT                   /product="pntAB NAD/NADP transhydrogenase subunit alpha"
FT                   /EC_number="1.6.1.2"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27262"
FT                   /db_xref="GOA:A5GQV3"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQV3"
FT                   /protein_id="CAK27262.1"
FT                   /translation="MNDALSLNDALWVLLLGSLLGLELIGKVPPTLHTPLMSGANAISG
FT                   ITVLAALTLIIKAGSSGNGGLMALGAVSLGFALFNVIGGFLVTDRMLAMFSRKPARQKE
FT                   KR"
     atgaacgacg ctctttccct gaacgacgcc ctctgggtgt tgctcctcgg cagcctgctg        60
     gggctcgagc tcattggcaa ggtgcctccc accctgcaca cgcctctgat gagtggcgcc       120
     aatgccattt caggaatcac cgtgttggcg gccctgacct tgatcatcaa ggctggctcc       180
     agtggcaatg gcggcctgat ggccttggga gccgtctccc tgggctttgc cctgttcaac       240
     gtgattggcg gctttttggt caccgatcga atgctggcca tgttcagccg taaacccgct       300
     cgccagaagg agaagcgctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page