(data stored in ACNUC29543 zone)

EMBL: CT978603.PROC

CT978603.PROC        Location/Qualifiers
FT   CDS_pept        439480..440322
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="SynRCC307_0471"
FT                   /product="Pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="Amino acid transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27374"
FT                   /db_xref="GOA:A5GR65"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5GR65"
FT                   /protein_id="CAK27374.1"
FT                   /translation="MPSTADSQLSFGVIGLGRMAQALLTPWLEAGLLQREQLQLSVASE
FT                   SSAQALRQRFDCPVHTDPSACLAVSELLLALKPQQLDGLVEQLGGRSAIAAAAASRSEP
FT                   PLLISVLAGVSSERLQDCFPGWRVVRTVPNTPALVRQGLVGLAFADGVSAEQQQRVQTL
FT                   FAAVGEVLELPESQLPAFLALTSSGPAFVALVAEALADGAVAAGLPRARAHHLAHRTLA
FT                   GTAALLFEQDLHPGELKDMVSSPAGATIAGIRVLEQSQLRSALMEAVVRAADRSRELG"
     atgccatcaa cggctgattc gcaattgagc tttggtgtga ttggcctggg ccgcatggcc        60
     caggcgctcc tgactccttg gcttgaggct ggcttgctgc aacgcgagca gctgcaactc       120
     tcggtggcct ctgagtcctc ggcgcaagcg ttgcgtcagc gctttgattg tccggtccac       180
     accgacccaa gcgcttgttt ggctgtttcg gagttgttgt tggccctcaa gccgcagcag       240
     ctcgatggct tggtggagca attgggaggc cgatcggcga ttgccgctgc tgcagcgagc       300
     cgatccgagc ctccgctgct catctctgtg ttggctggtg tgagctcaga gcgcttgcag       360
     gattgctttc cgggttggcg ggtggtgcgc accgtgccca acacgcctgc gttggtgagg       420
     cagggtctgg tggggttggc gttcgctgat ggggtgagcg ctgagcagca gcagcgcgtg       480
     cagaccttgt ttgccgcggt gggtgaggtg ctcgaacttc ccgagagtca gctgcctgca       540
     tttttggcgt tgacctcatc aggcccggct tttgtggcgt tggtggccga agccctcgcc       600
     gatggagccg ttgccgccgg attgcctcgc gcccgtgccc atcacctggc ccatcgcaca       660
     ctcgcgggaa cggctgcctt gttgtttgag caggacctgc accccggaga actcaaagac       720
     atggtcagca gtccggcggg cgccacgatc gccggtatcc gtgtgctgga gcaatcgcag       780
     ttgcgttcag cgttgatgga ggcggtggtg cgtgcggctg atcgcagccg cgaactcggt       840
     tag                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page