(data stored in ACNUC29543 zone)

EMBL: CT978603.PSBD

CT978603.PSBD        Location/Qualifiers
FT   CDS_pept        256888..257946
FT                   /transl_table=11
FT                   /gene="psbD"
FT                   /locus_tag="SynRCC307_0259"
FT                   /product="Photosystem II D2 protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27162"
FT                   /db_xref="GOA:A5GQK3"
FT                   /db_xref="InterPro:IPR000484"
FT                   /db_xref="InterPro:IPR005868"
FT                   /db_xref="InterPro:IPR036854"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQK3"
FT                   /protein_id="CAK27162.1"
FT                   /translation="MTIAVGRAPAGRGWFDVLDDWLKRDRFVFVGWSGLLLFPCAYMAL
FT                   GGWLTGTTFVTSWYTHGIASSYLEGCNFLTAAVSTPADSMGHSLLLLWGPEAQGDFVRW
FT                   CQLGGLWAFVALHGAFGLIGFMLRQFEIARLVGIRPYNAIAFSGPIAVFVSVFLMYPLG
FT                   QSSWFFAPSFGVAAIFRFLLFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTL
FT                   FEDGDGANTFKAFEPTQEEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVMGLWT
FT                   SSIGIIGLALNLRAYDFVSQELRAAEDPEFETFYTKNILLNEGLRAWMAPADQPHENFI
FT                   FPEEVLPRGNAL"
     atgacgatcg ccgttgggcg tgcaccagct gggaggggat ggttcgacgt cctcgatgac        60
     tggctgaagc gcgaccgttt cgtttttgtg ggctggtccg gcctgctgct gttcccttgt       120
     gcctacatgg cgctgggtgg ctggctcacc ggcaccacct ttgtcacttc ctggtacacc       180
     cacggaattg ccagcagcta cctcgagggc tgcaacttcc tcaccgctgc ggtttccacc       240
     ccggcggact ccatgggcca cagcctcttg ctgctgtggg gccctgaagc ccaaggcgac       300
     ttcgtgcgtt ggtgccaact cggcggcctc tgggccttcg ttgcactgca cggtgcattc       360
     ggcctgatcg gtttcatgct gcgtcagttc gaaattgccc gtctggtggg cattcgtcct       420
     tacaacgcca tcgccttctc cggcccgatt gcggtgttcg tcagcgtttt cctgatgtac       480
     cccctcggcc agagcagctg gttctttgct ccttctttcg gcgtggcagc gatcttccgc       540
     ttcctgctgt tcctgcaggg cttccacaac tggaccctga accccttcca catgatgggc       600
     gtggccggca tcctcggcgg cgcactgctg tgcgccatcc acggcgccac ggtggaaaac       660
     accctgtttg aagacggtga cggcgccaac accttcaagg cgtttgagcc cacccaagaa       720
     gaggagacct attcgatggt caccgccaac cgcttctgga gtcagatctt tggtatcgct       780
     ttctccaaca agcgctggct gcacttcttc atgctgttcg tgcctgtgat gggcctgtgg       840
     accagctcca tcggcatcat tggcctggca ctgaacctgc gcgcctatga cttcgtcagc       900
     caggaactcc gggctgctga agaccctgag ttcgagacct tctacacgaa gaacattctt       960
     ctgaacgaag gcctgcgcgc ctggatggct ccggccgacc aaccccacga aaacttcatc      1020
     ttccccgaag aggtcctgcc ccgcggcaac gctctttga                             1059
//

If you have problems or comments...

PBIL Back to PBIL home page