(data stored in ACNUC29543 zone)

EMBL: CT978603.PSBE

CT978603.PSBE        Location/Qualifiers
FT   CDS_pept        complement(211000..211251)
FT                   /transl_table=11
FT                   /gene="psbE"
FT                   /locus_tag="SynRCC307_0210"
FT                   /product="Cytochrome b559 alpha subunit (PSII reaction
FT                   center subunit V)"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27113"
FT                   /db_xref="GOA:A5GQF4"
FT                   /db_xref="InterPro:IPR006217"
FT                   /db_xref="InterPro:IPR013081"
FT                   /db_xref="InterPro:IPR013082"
FT                   /db_xref="InterPro:IPR037025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF4"
FT                   /protein_id="CAK27113.1"
FT                   /translation="MAAGSTGERPFFEIITSIRYWVIHAVTLPAIFLAGFLFVSTGLAY
FT                   DAFGTPRPDSYFQAADVKAPVVSQRYEGKSQLDTRLKN"
     atggccgccg gctcaaccgg ggaacgtccg ttcttcgaaa tcattacgag catccgctat        60
     tgggtgatcc atgcagtgac cttgcctgcg atcttcctgg ctgggttcct cttcgtcagc       120
     actgggctgg cttacgacgc cttcgggact ccgcgtcctg acagctactt ccaagccgct       180
     gacgtcaagg cgcctgtggt gagccagcgt tatgagggca agtcgcaact ggacacccgt       240
     cttaaaaact ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page