(data stored in ACNUC29543 zone)

EMBL: CT978603.PSBJ

CT978603.PSBJ        Location/Qualifiers
FT   CDS_pept        complement(210513..210713)
FT                   /transl_table=11
FT                   /gene="psbJ"
FT                   /locus_tag="SynRCC307_0207"
FT                   /product="Photosystem II reaction center J protein"
FT                   /note="Photosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27110"
FT                   /db_xref="GOA:A5GQF1"
FT                   /db_xref="InterPro:IPR002682"
FT                   /db_xref="InterPro:IPR037267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQF1"
FT                   /protein_id="CAK27110.1"
FT                   /translation="MSGKKSGLPDGRVPDRNPDGTPAVPWKSRWTEGPLPLWLVATAGG
FT                   MAVMFVVGLFFYGSYVGVGSA"
     atgagtggaa agaaatcagg tcttcccgac ggacgggtac cggatcgcaa tcctgatggc        60
     acgccggccg tgccctggaa aagccgttgg actgaaggcc ctctacccct ctggctggtc       120
     gctacagcag gtggaatggc cgtgatgttt gttgtgggtc tcttcttcta tgggtcttac       180
     gttggtgttg gttcagctta a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page