(data stored in ACNUC29543 zone)

EMBL: CT978603.PSPA

CT978603.PSPA        Location/Qualifiers
FT   CDS_pept        592000..592767
FT                   /transl_table=11
FT                   /gene="pspA"
FT                   /locus_tag="SynRCC307_0652"
FT                   /product="Phage shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27555"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRP6"
FT                   /protein_id="CAK27555.1"
FT                   /translation="MGFFDRVGRLFRANLNDLVSRAEDPVKILEQSVADMQSDLIKLRQ
FT                   AVATAIASQKRIQNQAEQAENQAQTWYQRAELALKKGEEDLAKEALSRRKTYQETATAL
FT                   NGQLNAQGGQVEALKKNLLALESKIAEARTKKDMLKARAQAAQAQAQLQGAVGGLNTNG
FT                   SMAAFERMEEKVQALEAQGQAAAEIAGADLDSRFQALESGDDVDADFEALKASVNPTPL
FT                   ALPDEKAKPQLQPAQQAQVDEELESLKRSIDQL"
     atgggctttt ttgatcgtgt cgggcgtctg tttcgcgcca acttgaacga tctggtcagc        60
     cgggcggaag atcccgtcaa gatcctggag cagtccgttg ccgacatgca gtcggacctg       120
     atcaagctgc gccaggccgt ggccactgca atcgccagcc aaaaacgcat ccaaaaccag       180
     gccgagcagg ccgaaaacca ggcgcagacc tggtaccagc gggcggagtt ggcactcaaa       240
     aaaggtgagg aggatctggc caaagaagcc ctcagtcgcc gcaagaccta tcaggagact       300
     gccaccgctc tcaatggcca gctcaatgcc cagggcggtc aggtggaggc cctgaaaaag       360
     aacctcttgg ccctcgagag caagatcgcc gaggcccgca ccaaaaaaga catgctcaag       420
     gcccgggccc aagccgccca ggcccaggcc cagttgcaag gagccgtggg tgggctgaac       480
     accaatggct cgatggctgc ctttgagcgc atggaggaga aagtccaagc gctggaggcc       540
     cagggccagg ctgccgccga gattgccggc gctgatcttg atagtcggtt ccaggccctg       600
     gaatccggcg atgacgtgga tgccgacttt gaggccctca aggccagcgt caatcccaca       660
     ccgttggccc tgcccgatga gaaggccaag ccccaactgc agcctgccca gcaggcccag       720
     gtcgatgagg agctcgagtc gctgaagcgc tcgatcgatc agctctaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page