(data stored in ACNUC29543 zone)

EMBL: CT978603.RPLT

CT978603.RPLT        Location/Qualifiers
FT   CDS_pept        complement(54293..54640)
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="SynRCC307_0059"
FT                   /product="50S ribosomal protein L20"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26962"
FT                   /db_xref="GOA:A5GQ03"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ03"
FT                   /protein_id="CAK26962.1"
FT                   /translation="MARVKRGNVARNRRNKILRLARGFQGSNGTLFRTANQRVMKALCN
FT                   AYRDRRRRKRDFRRLWIARINAAARMNGVSYSRLIGGLKKADVRINRKMLAQLAVLDPS
FT                   GFETVVAAAKS"
     atggcccgcg ttaagagggg caacgtcgcc cgcaaccgcc gcaacaagat cctccgcctc        60
     gcgcgcggct tccagggaag caatggcacc ctcttccgca ccgccaacca gcgggtgatg       120
     aaggcgttgt gcaacgccta ccgcgatcgt cgccgccgca agcgtgattt ccgtcgtctc       180
     tggattgcac ggatcaatgc cgcagctcgc atgaacggcg tcagctacag ccgtttgatc       240
     ggtggcctca agaaggctga tgtgcgcatc aaccgcaaga tgctggccca actggccgtg       300
     ctggatccct ccggcttcga aaccgtggtg gctgccgcca agtcctga                    348
//

If you have problems or comments...

PBIL Back to PBIL home page