(data stored in ACNUC29543 zone)

EMBL: CT978603.RPMI

CT978603.RPMI        Location/Qualifiers
FT   CDS_pept        complement(54683..54883)
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="SynRCC307_0060"
FT                   /product="50S ribosomal protein L35"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26963"
FT                   /db_xref="GOA:A5GQ04"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ04"
FT                   /protein_id="CAK26963.1"
FT                   /translation="MPKLKTRRAAAKRFRVTGSGKFMRRRAFHNHLLDHKSPKRKRYLG
FT                   TMAVVDERDHDRVSHMLPYAG"
     atgccaaagc tcaagactcg ccgggccgca gccaagcgtt tccgtgtcac gggcagcggc        60
     aagttcatgc gtcggcgcgc gttccacaat cacttgctcg accataagag ccctaagcgc       120
     aagcgctacc tgggcaccat ggctgtggtt gatgagcgcg accacgaccg ggtgagccac       180
     atgctcccct acgccggctg a                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page