(data stored in ACNUC29543 zone)

EMBL: CT978603.RSBU

CT978603.RSBU        Location/Qualifiers
FT   CDS_pept        13911..15284
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /locus_tag="SynRCC307_0012"
FT                   /product="Serine phosphatase RsbU, regulator of sigma
FT                   subunit"
FT                   /note="Signal transduction mechanisms / Transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26915"
FT                   /db_xref="GOA:A5GPV6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A5GPV6"
FT                   /protein_id="CAK26915.1"
FT                   /translation="MGGTPPAHRSPAAITPAASLRQLIDSLNREQRRNQELLASLGFAL
FT                   RSFTNLSRFLELVPLLTARLVEAEGAVLLTFRSDGGLWREQLHCSSQSRCGELLRQLAG
FT                   LQDSDLDRDAGDEAMATRLDQLVRRQLGDVQLFGTSVVAKNRQRGRLYVFSGDPQFSWS
FT                   EVRRRHVQLVADQTAVAIENELLLEEMRRHERLDQQLSIGGEIQSQLLPSRCPVIEGVE
FT                   LAARCRPAFQVGGDYFDFIPTRPQLLGKRREQGRWALVMGDVMGKGIPAGLLMTLLRGM
FT                   LRAEVLTGLPPDRILHDLNELAQEDLAQSNRFVTLFYSELDPVTRVLRFSNAAHNPPLI
FT                   WRRQRHSVERLDAPGLLIGLQPDADYGCEQVQLEPGDVLLYYTDGVTEASGVGGERFDE
FT                   ERLMRALLAICKTVPDAQGILDQLFARLDRFVGPGRQLEDDASMVVLKVRDEVVLPTL"
     atgggcggta cgccgcctgc ccatcgctct cctgcggcga tcacgccggc agcttcgctg        60
     cgccagctga tcgacagcct caaccgtgaa cagcggcgca atcaggagct gttggcttcg       120
     ttggggtttg ccctgcgcag cttcaccaac ctcagccgtt ttctcgagtt ggtgccgttg       180
     ctaacggcgc gcttggtgga agccgaaggt gctgtgttgc tcacctttcg cagtgatggt       240
     ggtctttggc gcgagcagct gcattgctca tcccagtccc ggtgcggcga gttgttgcgg       300
     cagttggcgg ggttgcaaga cagcgacctc gatcgcgatg ccggcgatga agccatggcc       360
     acccgcctgg atcagttggt gcgccgacag ctgggggatg tgcagttgtt tggcacctcc       420
     gtggtggcca agaaccggca acgcgggcgg ttgtatgtct tcagcggcga tccccagttc       480
     tcctggagtg aagtgcgccg ccgtcacgtg cagctggtgg ctgatcaaac cgctgtcgcg       540
     atcgagaacg aattgctgct cgaggagatg cggcgccatg agcgcctcga tcagcagctg       600
     agcatcggcg gtgagattca gtcccagctg ctccccagcc gctgcccggt gattgaaggg       660
     gtcgagttgg ctgcccgctg ccggccggcg tttcaagtcg gtggcgacta cttcgatttc       720
     atcccgaccc gtcctcagct gctgggcaag cgccgtgagc aaggtcgctg ggccttggtg       780
     atgggtgatg tgatgggcaa gggcatccca gcaggtctgt tgatgaccct gctgcggggc       840
     atgttgcgcg ctgaggtgct caccggcctg ccgcccgatc gaatcctgca tgacctcaat       900
     gaactggctc aggaggattt ggcgcagtcc aaccgctttg tgaccctctt ttattccgag       960
     ttggatccag tcacgcgggt gctgcgtttc agcaatgccg cccacaaccc gccgctgatt      1020
     tggcgccgcc agcgccacag cgttgagcgc ttggatgctc ctggattgct gattggcctg      1080
     cagccagatg ccgactacgg ctgcgaacag gtgcagctgg agcctggtga tgtgctgctc      1140
     tattacaccg atggcgtcac tgaagccagc ggcgttggtg gagagcgctt tgatgaggaa      1200
     cggttgatgc gggccttgct tgccatctgc aaaaccgttc ctgatgccca gggaatcctc      1260
     gatcagttgt ttgcgcgatt ggatcgcttc gtcgggcccg gccggcagct ggaggacgat      1320
     gcctcgatgg tggtcttgaa agtccgtgat gaggtggttt tacccaccct ttaa            1374
//

If you have problems or comments...

PBIL Back to PBIL home page