(data stored in ACNUC29543 zone)

EMBL: CT978603.RSMB

CT978603.RSMB        Location/Qualifiers
FT   CDS_pept        508390..509754
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="SynRCC307_0574"
FT                   /product="Ribosomal RNA small subunit methyltransferase B"
FT                   /EC_number="2.1.1.-"
FT                   /note="Translation, ribosomal structure and biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27477"
FT                   /db_xref="GOA:A5GRG8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRG8"
FT                   /protein_id="CAK27477.1"
FT                   /translation="MSKGRCPCGAICGHRSCPFVLSPDSAVGLPPRLVAWRVLEAVGDG
FT                   AYADLALERELKRSKLSPRDRGLATELAYGAIRQRRRLDGWLDLLGKVPAAKQPPRLRW
FT                   LLHVGLQQILLMDRVPASAAVSTAVELAKRERLQRLAPVVNGVLRAAVRAVEAGESLPV
FT                   PSDPQKRLALEHSLPDWLVAELWGQIGPERTEALAAASNRIPPLDLRCNRLRSSREALL
FT                   ENLPAVALAELPDGLTLTSRPGPLPQLAGFSEGQWCVQDRAAQRIAPLLDPKPGQRVLD
FT                   ACAAPGGKTTHIAELMGDQGEVVAVDVAPRRLQQVSANAERLGLSCIRTEAADATDLTD
FT                   WEAESFDRVLLDVPCSGLGTLARHADARWNLKPDGIEELVGLQHQLLEQGARLLKPDGR
FT                   LVYATCTVHPAENTGVVEAFVEENPDWQFSEPPMQLWPDPQGGDGFFAAVLSLRR"
     gtgagcaagg ggcgttgccc ttgcggcgct atctgtggac accggagctg cccattcgta        60
     ttgagccctg attccgctgt tggtttgccg ccgcgcctgg tggcctggcg agtgttggag       120
     gcggtggggg atggggccta tgccgatctg gccctcgagc gcgagctcaa gcgcagcaaa       180
     ctcagccccc gcgatcgcgg tttggccacc gagctggcct atggcgccat ccgccagcgc       240
     cggcgcctgg atggttggct tgatctcctt ggcaaggtgc cagccgccaa gcagccgccg       300
     cggctgcgct ggcttctgca tgtgggcctg cagcagattt tgctgatgga ccgggtgcct       360
     gcatcggcgg ccgtgagcac ggcggtggag ctggccaaac gcgaacggct gcagcgcttg       420
     gcaccggtgg tgaatggggt gctgcgcgcg gcggtgcggg ccgttgaggc cggcgaaagc       480
     ctgcctgtgc ccagtgatcc ccaaaaacgc ttggccctgg agcactccct gcccgattgg       540
     cttgtcgccg agctgtgggg gcagatcggc cctgagcgca ccgaggcgtt ggcagcggcg       600
     agcaaccgca tcccgccgct tgatctgcgc tgcaaccgcc tgcgcagcag ccgtgaggcc       660
     ctgcttgaaa accttccagc tgtggcctta gcggagctgc ccgatgggct caccctcacc       720
     agccgcccgg gaccgttgcc gcagctggct ggtttcagcg aaggccagtg gtgcgtgcaa       780
     gatcgcgccg cccagcgcat tgcaccgctg ctggatccaa agcccggtca gcgggtgctg       840
     gatgcctgcg cggcccccgg cggcaagacc acccacatcg ctgagttgat gggcgatcaa       900
     ggcgaggtgg tggcggttga tgtggcgcca aggcggctgc agcaggtgag cgccaatgcc       960
     gagcgcttgg gcttgagctg catccgcacc gaagcggctg acgccaccga cctcaccgat      1020
     tgggaggccg aaagctttga tcgggtgctg ctcgatgtgc cctgctcagg gctgggcacc      1080
     ttggcgcgcc atgccgatgc ccgctggaac ctcaaacccg atggcatcga ggagttggtg      1140
     ggcctgcagc accagttgct ggagcagggc gcgcggctac tcaaacccga tggccgcttg      1200
     gtctacgcca cctgcacggt gcaccccgca gagaacacag gcgtggtgga ggcctttgtg      1260
     gaggaaaacc ccgattggca attcagtgag ccgccaatgc agctgtggcc cgatccgcaa      1320
     ggcggcgatg gcttctttgc tgcggtgctc agcctccggc ggtga                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page