(data stored in ACNUC29543 zone)

EMBL: CT978603.SALX

CT978603.SALX        Location/Qualifiers
FT   CDS_pept        complement(596018..596695)
FT                   /transl_table=11
FT                   /gene="salX"
FT                   /locus_tag="SynRCC307_0658"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /note="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27561"
FT                   /db_xref="GOA:A5GRQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5GRQ2"
FT                   /protein_id="CAK27561.1"
FT                   /translation="MGSNPVAELRHIHKVYGSGDTEVRAVNDLNLTVEAGDYIAVMGAS
FT                   GSGKSTAMNILGCLDRPSSGSYLLQGQQVDGLSDDALAILRNRCLGFVFQQFHLLGHLS
FT                   AQENVELPMVYANVPAEERQQRAVEALQRVGLGQRLRNKPNQLSGGQQQRVAIARAIIN
FT                   RPALLLADEPTGALDSETTADVLEIFDQLNGDGMTVVLVTHEHDVAERAKQRVLFRDGR
FT                   IAN"
     atgggcagca acccggtggc cgagctgcgc cacatccaca aggtctatgg cagcggcgat        60
     acggaggtga gggcggtcaa cgacctcaac ctcaccgttg aagccggcga ttacatcgcc       120
     gtgatgggcg cgagcggctc aggcaaaagc acggcgatga acatcctggg ttgcctcgat       180
     cgccccagca gcggcagcta cctgctgcag ggccaacagg tggatggcct cagtgatgac       240
     gccttggcga tcctgcgcaa ccgctgcctg ggctttgtct ttcagcagtt ccacctgctc       300
     ggccatctct cggcccagga aaacgttgaa ctgccaatgg tctacgccaa tgtgcccgcc       360
     gaagaacggc agcagcgggc cgtggaagcg ttgcaacggg tgggcctggg ccagcggctg       420
     cgcaacaagc ccaaccaact cagcggcggc cagcagcaac gggtggccat tgcccgagca       480
     atcatcaacc gccccgccct gctgctcgcc gatgaaccca ccggggccct ggattcggaa       540
     accaccgccg atgtgttgga gatctttgat cagctcaacg gcgatggcat gaccgtggtg       600
     ctggtgaccc acgagcacga tgtggccgag cgggccaaac agcgggtgct gttccgcgac       660
     ggacgcatcg ccaactga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page