(data stored in ACNUC29543 zone)

EMBL: CT978603.THIC

CT978603.THIC        Location/Qualifiers
FT   CDS_pept        123610..125010
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="SynRCC307_0129"
FT                   /product="Thiamine biosynthesis protein ThiC"
FT                   /note="Coenzyme metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27032"
FT                   /db_xref="GOA:A5GQ73"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQ73"
FT                   /protein_id="CAK27032.1"
FT                   /translation="MRSAWIEKRRGSANVSQLHYARQGVVTEEMAYVAKRENLPESLVM
FT                   EEVARGRMIIPANINHANLEPMAIGIASKCKVNANIGASPNASDASEEVKKLELAVKYG
FT                   ADTVMDLSTGGVNLDEVRTAIINASPVPIGTVPVYQALESVHGSIERLSEDDFLHIIEK
FT                   HCQQGVDYQTIHAGLLIEHLPKVKGRLTGIVSRGGGILAQWMLYHHKQNPLYTRFEDIC
FT                   EIFKRYDCTFSLGDSLRPGCQHDASDDAQLAELKTLGELTRRAWKHDVQVMVEGPGHVP
FT                   MDQIEFNVKKQMEECSEAPFYVLGPLVTDIAPGYDHITSAIGAAMAGWHGTAMLCYVTP
FT                   KEHLGLPNADDVREGLIAYKIAAHAADIARHRPGARDRDDELSRARYAFDWNKQFELSL
FT                   DPERAKEYHDETLPADIYKQAEFCSMCGPKHCPMQTKITDKDLESLEEVLKAKGGAELS
FT                   TAKLDRAD"
     atgcgcagtg cctggattga gaagcgccgc ggcagtgcca atgtcagcca gctccattac        60
     gcccgccagg gcgtggttac cgaagaaatg gcctatgtgg ccaaacggga gaacctgccg       120
     gaatcgctgg tgatggagga ggtggctcgg ggtcgcatga tcatcccggc caacatcaac       180
     cacgcgaatc tggagccgat ggccatcggc atcgccagca agtgcaaggt gaacgcgaat       240
     atcggcgcgt cccccaatgc ctccgatgcc tcggaagagg tgaagaagct ggagctggct       300
     gtgaaatatg gcgccgacac cgtgatggat ctctcaaccg gtggcgtgaa cctcgatgag       360
     gtgcgcacgg cgatcatcaa cgcgtcgcca gtgcctatcg gcaccgtgcc cgtctaccag       420
     gccctcgaga gcgtgcatgg ctcgatcgag cgcctctcag aagatgattt cctgcacatc       480
     atcgagaagc actgccagca aggcgttgat taccaaacga tccatgcggg cctgctgatt       540
     gagcacctgc ccaaagtcaa gggccgtttg accgggatcg tcagccgtgg tggcgggatc       600
     ttggcccagt ggatgctcta tcaccacaag cagaaccctc tctacacccg ctttgaagac       660
     atctgcgaga tcttcaagcg ctacgactgc accttctcct taggtgactc tttgcggcct       720
     ggctgtcagc acgatgcctc tgacgatgcc cagctggctg aactcaagac cctgggagag       780
     ctcacccgcc gcgcttggaa gcatgacgtt caggtgatgg tggaaggccc cggccatgtg       840
     ccgatggacc agatcgagtt caacgtcaaa aagcagatgg aggagtgcag cgaagccccc       900
     ttctacgtgc tcggtccact cgtgactgac atcgctcctg gctacgacca catcaccagt       960
     gccattggtg ctgcgatggc cggctggcat ggcaccgcca tgctctgcta tgtcaccccc      1020
     aaagaacacc tgggtctgcc gaacgcagac gatgtgcggg agggcttaat cgcctacaag      1080
     atcgctgccc acgccgccga cattgcccga caccgtcctg gtgcccgtga ccgcgacgac      1140
     gagctcagcc gggcgcgcta cgccttcgac tggaacaagc agtttgagtt gtccctcgat      1200
     cctgagcggg ccaaggagta tcacgacgaa accctgccag ccgatatcta taagcaggca      1260
     gagttttgct cgatgtgtgg tccaaagcac tgcccgatgc aaaccaagat cactgataaa      1320
     gacctcgaga gcctggaaga ggtgctcaag gccaagggcg gggctgagct gagtacggcc      1380
     aagctcgatc gggcggacta a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page