(data stored in ACNUC29543 zone)

EMBL: CT978603.TMK

CT978603.TMK         Location/Qualifiers
FT   CDS_pept        253136..253774
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="SynRCC307_0254"
FT                   /product="Thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="Nucleotide transport and metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27157"
FT                   /db_xref="GOA:A5GQJ8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A5GQJ8"
FT                   /protein_id="CAK27157.1"
FT                   /translation="MRGRFLVLEGIDGCGKTTQLKALADWLPASGLMPSGAQLITTREP
FT                   GGTALGQALRQLLLHPPEEQAPATRAELLLYAADRAQHVQTRLEPALAAGDWVLSDRYC
FT                   GSTAAYQGYGRGLDLDLITQLEQLATAGLQPDLCLWLELSPELAAQRRSGQQQDRIEAE
FT                   GLAFLARVHQGFAELSQRPLWRRVDASLPPEQVHQQVQHLVREGLELAL"
     atgagaggcc ggtttctggt gctggagggc attgatggct gcggcaaaac cacgcagctc        60
     aaggccttgg ctgattggtt gccagccagt ggcctaatgc cctctggcgc gcagctgatc       120
     accacccgcg agcccggcgg caccgctttg ggccaggccc tgcggcaatt gctgctgcat       180
     cctcccgagg agcaggcccc ggccacccgc gctgagctgc tgctctacgc ggctgatcgc       240
     gcccaacatg ttcagacccg attggagcct gccttggctg ctggtgattg ggtgctcagt       300
     gatcgttatt gcggctccac cgccgcgtat cagggctatg gccgcggttt ggaccttgat       360
     ttgattaccc agctggagca gttggccaca gcggggttgc agccagatct ttgcctctgg       420
     cttgagctat cgcctgagct ggccgcccag cgccgctccg gccagcagca agaccgcatc       480
     gaagccgaag gtttggcttt tttggcgcgg gtgcatcaag gctttgccga gctgagccag       540
     cggccgcttt ggcggcgggt ggatgcctcg cttccccctg agcaggtgca tcagcaggtg       600
     cagcacttgg tgcgtgaggg tttggagttg gccctgtga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page