(data stored in ACNUC29543 zone)

EMBL: CT978603.UVRB

CT978603.UVRB        Location/Qualifiers
FT   CDS_pept        70629..72635
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="SynRCC307_0074"
FT                   /product="Helicase subunit of the DNA excision repair
FT                   complex"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAK26977"
FT                   /db_xref="GOA:A5GQ18"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQ18"
FT                   /protein_id="CAK26977.1"
FT                   /translation="MDFRLEAPYSPNGDQPTAIETLVQGVEGGQRYQTLLGATGTGKTF
FT                   SIANVIQRTGRPALVLAHNKTLAAQLCNELRQFFPHNAVEYFISYYDYYQPEAYVPVSD
FT                   TYIAKTASINEEIDMLRHSATRSLFERRDVIVVASISCIYGLGIPSEYLKAAVPFSVGE
FT                   TLNLRGSLRELVNNQYSRNDTEIARGRFRVKGDVLEIGPAYEDRLVRIELFGDEVEAIR
FT                   YVDPTTGEILQSLETINIYPAKHFVTPKDRLESAVGAIRQELRDRLDWLNANGKLLEAQ
FT                   RLEQRTVYDIEMLQQVGYCNGVENYARHLAGREAGTPPECLIDYFPDDWLLVVDESHVT
FT                   CSQLQAMYNGDRSRKQVLIDHGFRLPSAADNRPLKGTEFWDKAKQTIFVSATPGDWEMQ
FT                   VSDGQVAEQVIRPTGVLDPLIEVRPSGGQVDDLLGEIRVRAERNERVLVTTLTKRMAED
FT                   LSDYLAENQVKVRYMHSEIHSIERIEIIQDLRNGEYDVLVGVNLLREGLDLPEVSLVAI
FT                   LDADKEGFLRAERSLIQTIGRAARHVSGVALLYADNMTDSMVKAISETERRRAIQMAYN
FT                   EKHGITPHAAGKKSTHNPILAFLEMSRKLNDEQLDEAVEEAKQDAVPLENLPELIQQLE
FT                   ERMKGAASKLDFEEAANLRDRIKQLRQKLVGKA"
     gtggatttcc gcctcgaagc cccctacagc cccaacggcg atcaaccaac ggcgatcgag        60
     accctggtgc agggtgtcga gggggggcag cgctatcaga ccctgctggg tgccacgggc       120
     acgggcaaaa cgttttcgat cgccaatgtg attcagcgca ccggccgtcc ggcgctggtg       180
     ctggcccaca acaaaaccct ggcggcccag ctctgcaacg agctgcgcca gttctttccg       240
     cacaacgcgg tcgaatattt catctcttac tacgactatt accagcccga ggcctatgtg       300
     ccggtctcgg acacctacat cgccaaaaca gcgtcgatca acgaagagat cgacatgctg       360
     cgccactcag cgactcgctc gctgtttgag cgtcgcgatg tgatcgtcgt tgcctcgatc       420
     agctgcatct acggccttgg tatcccctcg gaatacctca aggcggccgt gccattcagc       480
     gttggcgaaa ccttgaatct gcgtggttcg ctgcgggagt tggtcaacaa ccaatacagc       540
     cgcaacgaca ccgaaatcgc ccgcggtcgt tttcgcgtca aaggggatgt gctggagatc       600
     gggcccgcct acgaagaccg cttggtgcgc attgagctct ttggcgacga ggtggaagcg       660
     attcgctatg tcgaccccac caccggcgag atcttgcaga gcctggagac gatcaacatc       720
     tatccggcca agcactttgt gacccccaaa gatcggctgg aatcagccgt cggtgcgatt       780
     cgtcaggagc tgcgcgatcg acttgattgg ctcaacgcca atggcaagtt gctggaagcc       840
     cagcggctcg agcagcgcac cgtctacgac atcgagatgt tgcagcaggt tggctactgc       900
     aacggcgttg aaaactatgc acgtcacttg gctgggaggg aagcaggaac ccctccggag       960
     tgcctgatcg attacttccc tgatgattgg ttgctggtcg ttgatgaaag ccatgtcacc      1020
     tgctcgcagc tgcaggccat gtacaacggc gaccgctcgc gcaagcaggt gctgatcgac      1080
     catggcttcc ggctccccag cgctgccgac aaccgccctt tgaaaggcac tgagttctgg      1140
     gacaaagcca aacaaaccat ctttgtcagc gccacgcccg gcgactggga gatgcaggtc      1200
     agcgatgggc aggtggcgga gcaggtgatt cgccccaccg gggtgcttga tcccctcatt      1260
     gaagtgcggc cctcgggtgg tcaggtggat gatctgctcg gtgagatccg tgtgcgcgct      1320
     gagcggaatg agcgggtgtt ggtgaccacg ctcaccaaac gcatggcaga ggacctcagc      1380
     gactacctgg cggaaaacca ggtcaaggtg cgctacatgc actcggagat tcactccatt      1440
     gagcgcatcg agatcattca ggacctgcgc aatggcgagt acgacgtctt ggtgggcgtc      1500
     aacctgctgc gggaaggctt ggatttaccc gaggtctccc tggtggcgat cttggatgcc      1560
     gacaaagaag gcttcctgcg ggcggaacgc tcgttgatcc agaccattgg ccgagcggcc      1620
     cgccacgtca gtggtgttgc tttgctctac gccgacaaca tgaccgattc gatggtcaag      1680
     gccatcagtg aaacggaacg gcggcgcgcc attcagatgg cctacaacga aaaacacggc      1740
     attacgccgc acgctgccgg taagaaatca acccacaacc cgatcctggc gttccttgag      1800
     atgtcgcgga agctcaatga tgagcagctc gatgaggcgg tggaagaggc caagcaagat      1860
     gccgtgcccc tggagaacct tcctgagctc attcagcagc tggaagagcg catgaaagga      1920
     gcggcctcca agcttgattt tgaggaagcc gccaatttgc gcgatcgcat caagcagttg      1980
     cgccaaaaac tggtgggcaa agcctga                                          2007
//

If you have problems or comments...

PBIL Back to PBIL home page