(data stored in ACNUC29543 zone)

EMBL: CT978603.XSEA

CT978603.XSEA        Location/Qualifiers
FT   CDS_pept        complement(356207..357361)
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="SynRCC307_0368"
FT                   /product="Exonuclease VII large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="DNA replication, recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:SynRCC307_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAK27271"
FT                   /db_xref="GOA:A5GQW2"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:A5GQW2"
FT                   /protein_id="CAK27271.1"
FT                   /translation="MELPAYSVSELNEAIGVLLERGFAPRFLVDGAVVKPVLKKGHLWF
FT                   SLSDGDASIQAVAWASTVARLSFRPNDGDGVRVVGKLNFWGARASLSVQALDIRPSLST
FT                   VLRRFEQVKQQLESEGLLDPALRRQLPQRPSCIAILTSVPSSALADLLRTAKQRWPACN
FT                   LRVVPIPVQGDVEKRICAVFDQLETQWQRLGIEAVVLARGGGSREDLSVFDGEDLARAL
FT                   LRCPVPVVSGIGHEDDVTIADLAADYRAATPTAAMVALLPDRQQEQQLLEQRGRHWRSS
FT                   IQNRLEQELRQWDPELRQDQRRALLQRNLERRQWQLHSQRQLLAALSPQRLLQRGYCLL
FT                   RSSEGQLLRNGSTLSAGDAVEAQLHQGVLSLTVQTWQPETSEVS"
     atggagctgc ccgcttacag cgttagcgag ctcaatgaag ccattggtgt gttgctggag        60
     cggggctttg ctcctcgctt tttggtcgat ggtgccgttg ttaaacccgt tctgaaaaaa       120
     ggccatctct ggttcagcct cagcgatgga gatgcctcca tccaagctgt ggcttgggcc       180
     tcaacggtgg cccggctcag ctttcgcccc aacgatggcg acggcgttcg cgtcgttggc       240
     aagctgaatt tttggggtgc acgcgccagc ttgagcgtgc aagccctcga catccgcccc       300
     agcctctcga cggtgctgcg ccgctttgag caggtgaaac aacagctcga gagtgaaggc       360
     ttactggatc cagccctgag gcggcagcta ccgcaacggc caagctgcat tgccatcctc       420
     accagcgttc ccagctcagc actggccgat ctgctgcgca ccgccaaaca gcgctggccc       480
     gcctgcaacc tgcgggtggt gccgatcccc gtgcaaggcg atgtggaaaa gcgcatctgc       540
     gcggtgtttg atcagctgga aacccagtgg caacggctcg gcattgaagc ggtggtgctc       600
     gccagaggcg gaggcagccg cgaagacctc agcgtctttg acggcgaaga cttggcccgg       660
     gccctattgc gctgcccggt gcctgtggtg agtggcatcg gccacgaaga cgatgtgacg       720
     atcgctgatc tcgccgctga ctaccgggcc gccactccca ccgccgccat ggtggcgctg       780
     ctgcccgatc gccagcagga gcaacagctg ctggagcagc gcggacgcca ttggcgcagc       840
     agcatccaaa accggttgga gcaggagctg agacagtggg acccagaact gaggcaagac       900
     cagcggcgtg ctctgctgca gcgaaacctg gaaagacggc aatggcagtt gcacagtcag       960
     cggcaattgc tcgcggcgct ctcgccccaa cgcttgctgc aacgggggta ctgcttgctg      1020
     cgcagcagcg aaggccagct gctgcgtaat ggcagcacac tcagcgcagg cgatgccgtc      1080
     gaagcccaac tgcatcaggg cgttctgtcg ttaacggtgc agacgtggca acctgaaacc      1140
     agtgaggtga gctga                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page