(data stored in SCRATCH zone)

EMBL: CU458745.PE12

CU458745.PE12        Location/Qualifiers
FT   CDS_pept        8776..9366
FT                   /transl_table=11
FT                   /locus_tag="MAB_p11"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I415_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p11"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59638"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE4"
FT                   /protein_id="CAM59638.1"
FT                   /translation="MTSKIGPWEEAITLAADWIWERSREEDLAPLLVSNAQNAASFGYA
FT                   DLDEIIRAGGHATPQSRSRPDRGPVLTFVPDERSLHFAMGLARGYSLAVVEGSTSLAEW
FT                   AAGAAAINLLTGQVTTSQVDDDVRKDLDSVIFYGGRNGWTGADEKAQVRRFLSDHIGGG
FT                   RLTPDQAAAYALSSQSVSDRGAKRLRELLSRNR"
     atgacgtcga agatcgggcc gtgggaagaa gccatcaccc tggccgccga ctggatttgg        60
     gaacgcagtc gcgaggagga tctagcgccg ctgctggtga gcaacgcgca gaacgcggcg       120
     agctttggtt atgccgacct cgacgagatc atccgagcgg ggggtcacgc cacaccgcag       180
     agccgtagcc gacccgatcg cggtccggta ctgacgttcg tgccagacga acggtcgttg       240
     cacttcgcga tgggcttggc tcggggctat tcgcttgctg tcgtcgaggg ctccacgtcc       300
     ttagccgaat gggctgctgg cgcggccgca atcaacctgc tgaccggaca ggtcacaacg       360
     tcccaagtcg acgatgatgt ccgcaaagac cttgactccg tcatcttcta cggcggtcgt       420
     aacggctgga caggggcaga tgaaaaggcg caggtgcgac ggtttctgag cgatcacatc       480
     ggcggcggcc gactgactcc cgatcaggcc gctgcgtatg ccttgtcgtc gcagtcggtg       540
     tccgaccgcg gagccaagcg cctgcgcgag ctgctcagcc gcaatcggtg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page