(data stored in SCRATCH zone)

EMBL: CU458745.PE13

CU458745.PE13        Location/Qualifiers
FT   CDS_pept        9533..10060
FT                   /transl_table=11
FT                   /locus_tag="MAB_p12"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I414_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p12"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59639"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAE5"
FT                   /protein_id="CAM59639.2"
FT                   /translation="MTMGYRRPHRTGVAVAATALVIAAGAAVTSGLALVRPIAPAQHTV
FT                   NVVAPPPAAHSSSETQAAKATACAAWDRAARSTALASKSSAEALEQSWTSPKSLAALAT
FT                   EKRTGVAAVSYLRTQLSDATPASTAIPLHEWMSANIDMLHALNMRHWDDADRQLKRGND
FT                   LTDVLTSECGLR"
     atgacgatgg ggtatcggcg gccccaccgc accggggtgg ccgtcgcagc gaccgcgcta        60
     gtgatcgccg ctggtgcagc ggtgaccagc ggcctggcgc tggtgcgccc catcgccccg       120
     gctcagcaca cggtcaacgt ggttgcaccc ccgccagccg ctcacagcag cagcgagacg       180
     caagccgcga aggctacggc atgtgctgcg tgggatcggg ccgcacggtc gacggcgttg       240
     gcgagcaagt ccagcgccga ggcgctggag cagagctgga caagcccaaa gagtctcgcc       300
     gcattggcca cggagaaacg cactggtgtg gctgcggtct cgtatctgcg tacgcagctg       360
     tctgacgcca caccagcttc aacggcgata ccgctgcatg agtggatgtc ggccaacatc       420
     gacatgctcc acgcgctgaa catgcggcat tgggacgacg ccgatcgcca actaaaacgc       480
     ggcaacgatc tgacggatgt cctcacgtct gagtgcgggt tgcgctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page