(data stored in SCRATCH zone)

EMBL: CU458745.PE3

CU458745.PE3         Location/Qualifiers
FT   CDS_pept        1491..1724
FT                   /transl_table=11
FT                   /locus_tag="MAB_p03"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Identical to B2I427_MYCMM"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_p03"
FT                   /db_xref="EnsemblGenomes-Tr:CAM59630"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B1MAD6"
FT                   /protein_id="CAM59630.1"
FT                   /translation="MIRTTVEALGGAQAVPSELIPVRELHQRLIDQVTTSGGNVVLADT
FT                   AGKPAAVVMSLQRYEQLLDELNTLRRRTADNA"
     atgatccgta ccaccgttga agccctcggc ggcgcgcagg ccgttcccag tgagctgatc        60
     ccggtccgcg aactgcatca gcgcctgatc gatcaggtga ccaccagtgg cggcaacgtc       120
     gtcctggccg acaccgccgg caagcccgcc gccgtggtca tgtcccttca gcgctacgag       180
     cagctgctcg acgagctgaa cacgctgcgc cgcagaaccg ccgacaacgc ctga             234
//

If you have problems or comments...

PBIL Back to PBIL home page