(data stored in ACNUC30630 zone)

EMBL: CU458896.PE106

CU458896.PE106       Location/Qualifiers
FT   CDS_pept        complement(110177..110743)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0109c"
FT                   /product="Putative copper resistance protein, CopC family"
FT                   /note="Similar to Q271J2_MYCFV 2e-29"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0109c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60209"
FT                   /db_xref="GOA:B1MEE5"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEE5"
FT                   /protein_id="CAM60209.1"
FT                   /translation="MAVLRKSVSVFVSAFIALTLGLALPAVASAHAVKVSSDPAENAVL
FT                   SGPPVQVSATFNEPLQKRFSAMTVIGPDDKTDQWQAGDPVVSGAVISVGVKAGAPAGKY
FT                   TVNYRVISEDGHPVDGSWAFTITGSGSSAAAGAPAISQQPSGTTSSAPVPSANPTDGDL
FT                   PMWPFVVAVVVSVGAALIWTQRRQS"
     atggctgtac tgcggaaatc ggtatcggtg ttcgtgtcgg cattcatcgc gttgacgctt        60
     ggcctggcgt tgcccgccgt ggcctcggcg cacgcggtca aggtttcctc cgacccggcc       120
     gagaatgcgg tgctgtccgg gcctcccgtg caggtcagtg ccaccttcaa cgaaccgctg       180
     cagaagcgtt tctccgcgat gacggtcatc ggcccggatg acaagaccga ccaatggcag       240
     gccggtgatc cggtggtttc gggcgcggtg atttctgtcg gggtgaaggc cggagccccc       300
     gccggtaagt acacggtcaa ctatcgggtg atctccgaag acgggcatcc ggtggacggg       360
     tcgtgggcat tcaccatcac cggttcgggt tcgtcggccg ctgcgggcgc acctgcgata       420
     tcgcagcagc catcggggac aacctcctct gcaccggtgc cgtcggccaa ccccaccgat       480
     ggcgacctac ccatgtggcc gtttgtggtc gccgtggtgg tctcggtggg agccgcgctg       540
     atctggactc agcgccgtca gtcgtaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page