(data stored in ACNUC30630 zone)

EMBL: CU458896.PE107

CU458896.PE107       Location/Qualifiers
FT   CDS_pept        complement(110743..111411)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0110c"
FT                   /product="Conserved hypothetical membrane protein"
FT                   /note="Similar to Q745I0_MYCPA 1e-38"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0110c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60210"
FT                   /db_xref="GOA:B1MEE6"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEE6"
FT                   /protein_id="CAM60210.1"
FT                   /translation="MRRVLPRLVAVSTTAAAALVALAIPASAHVRVTTDNTARGGYATL
FT                   EFSVPNESQTKSLTTELTVRLPDVGSASTELLPGWTSAVDRDTAKGTVKSVTWKAVAGN
FT                   GIGPDQFALFRVRVKLPDTDSVTFPATQTYADGQVVTWDQQAQPGGAEPEHPAPALDLT
FT                   QGKADHDGHSAHAPQVSVTHESGAHEAHPDKTARWFGGIGLILGAVALVLAVTNKRRQQ
FT                   "
     atgcggcgcg tactcccccg gctggtcgcg gtgtcgacca cggcagcagc ggcccttgtg        60
     gcgctcgcga ttccggcctc cgcgcatgtg cgggtcacca ccgacaacac cgcacgcggc       120
     ggctacgcga cgctggagtt ctcggttccc aacgagtccc agaccaagtc actgaccacc       180
     gagctgaccg ttcggttgcc ggatgtcggc tcggccagca ccgaactgct accgggctgg       240
     accagcgcgg tagatcgcga caccgccaag ggcacagtca agtcggtcac ctggaaagcc       300
     gtggccggca acgggatcgg acctgatcag ttcgctttgt tccgcgtgcg cgtcaagctc       360
     cctgataccg attcggtgac cttccccgcg acccagacat acgccgacgg tcaggtggtc       420
     acgtgggatc aacaggcgca gcccggcgga gccgagccgg agcatccggc gcccgccctg       480
     gacctgaccc agggcaaggc cgaccacgac ggccactcgg cacacgcacc tcaggtatcg       540
     gttacccatg aatccggggc acacgaagcg cacccggaca agacggcgcg ctggttcggc       600
     ggcatcgggc tgattctcgg tgctgtcgcc ctcgtgctcg ctgtgacgaa caagcggagg       660
     caacagtga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page