(data stored in ACNUC30630 zone)

EMBL: CU458896.PE108

CU458896.PE108       Location/Qualifiers
FT   CDS_pept        complement(111415..112071)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0111c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q25ZD9_MYCVN 3e-39"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0111c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60211"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEE7"
FT                   /protein_id="CAM60211.1"
FT                   /translation="MGFLTSRKSRSTKRAEARALKAKAKLEARLAARNDRRRMRVQARS
FT                   ESAARRDARKTELATLKAQRQIAQDQLRAVREGKLLSPTRIKRTLTVVRLLAPVLLPLL
FT                   YKAAIAVRGVLDQRRADRLGIPLAELGQYSGFGAELSARIAGAEQSLQAVLDRAPKDAE
FT                   TKKFTATVRARLEELGTAVGASEHMPPTRRRAAHAAIARELDGIDADLLARLGVR"
     atgggttttc tcaccagccg caagagccgc tcgacgaaac gtgccgaggc gcgggcgctg        60
     aaggcgaaag ccaagctcga agcccggttg gcggcgcgca atgaccggcg caggatgcgc       120
     gtacaagcgc ggtcggagtc cgctgcccgg cgcgacgcgc gcaagacgga gctggcgacg       180
     ctgaaggccc agcggcaaat cgcccaggat cagctcaggg cggtgcggga aggcaagctg       240
     ctctcgccca cccggatcaa gcgcacgctc acggttgtgc ggctgctagc tcctgtgctg       300
     ttgccgctgc tgtacaaggc ggccatcgcg gtccgtgggg tcttggacca gcgccgcgcc       360
     gatcgactcg gcataccgct ggccgagctg ggccagtact cgggattcgg cgcagaactg       420
     tcggcccgta tcgccggcgc cgaacagtcg ctacaggccg tgctggaccg tgcgcccaag       480
     gatgccgaga ccaagaagtt cactgccacc gttcgtgccc ggctcgagga attgggtacc       540
     gcggtggggg catccgaaca catgccgccg acccggcggc gcgcggcaca tgccgccatc       600
     gcccgcgagc tggacggcat tgacgcggat ctgctcgcac gactcggagt gaggtaa          657
//

If you have problems or comments...

PBIL Back to PBIL home page