(data stored in ACNUC30630 zone)

EMBL: CU458896.PE11

CU458896.PE11        Location/Qualifiers
FT   CDS_pept        complement(11717..12328)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0011c"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0011c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60114"
FT                   /db_xref="InterPro:IPR024520"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME50"
FT                   /protein_id="CAM60114.1"
FT                   /translation="MKIFHHIALMSAVALTVVGCGGNTVSGDAITATNTARAGHDTATS
FT                   SSPTVTNTLPGPHPPPNQNSDGTTFDPCLAYSAAELSKWGLDPATVKDIGATTTLQRGC
FT                   SWQGDGWYVQQLVINRSISEYLDTNNYPDAKPVAIAGLQGSTHRLGQSGTAFCSAQIPS
FT                   QRAVVATLVSLDRPSAQKAIGDACTKAIEIATDTVPKLPK"
     gtgaagatct tccatcacat cgcgctcatg tcggcggtgg cactcaccgt cgttggctgt        60
     ggcggcaata ccgtgtctgg ggacgcgatt actgccacaa atactgcgcg cgccggacac       120
     gatactgcca caagttcctc acctactgtc actaacacgc tccccggacc gcacccgccc       180
     cctaaccaaa atagtgacgg cactaccttc gatccctgtt tggcctacag tgcggcggaa       240
     ttgagcaaat ggggactcga tcccgccaca gttaaggaca tcggcgccac cacgacactc       300
     cagcggggtt gcagctggca gggggacggc tggtacgtcc agcaactcgt gatcaatcgc       360
     tccatttcag agtacttgga taccaataac tatcccgacg ccaagcccgt ggctatcgcc       420
     ggactgcaag gctcgacaca tcgcttggga caatccggaa ctgctttctg ctcagcgcag       480
     attccgtccc aacgcgccgt cgtcgccacc ctcgtcagcc ttgacagacc aagcgcgcag       540
     aaagcgatcg gagatgcctg cacaaaagcc atcgagatcg ccaccgacac tgtcccgaag       600
     cttccgaaat aa                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page