(data stored in ACNUC30630 zone)

EMBL: CU458896.PE119

CU458896.PE119       Location/Qualifiers
FT   CDS_pept        120459..121622
FT                   /transl_table=11
FT                   /locus_tag="MAB_0122"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q274W3_MYCFV 2e-45"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60222"
FT                   /db_xref="GOA:B1MEF8"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEF8"
FT                   /protein_id="CAM60222.1"
FT                   /translation="MIQVCSRCGTQWNVREQRRYWCPRCRGTLLEPGMTAPPRPAASMS
FT                   RPPVGAPAPAGKYWVPPTQQGPVATPAGRPQARPTRLPAGYRWIAVRPGSPPAPARRRR
FT                   PLGPTPRYAYIPRWGLVDHIEPTGSSRQGIAGGAVPSRILDRLLLATIITLAITSCTHF
FT                   LRYALMVYNRGALIPRFVASASNGLVLISVALAFAVMAATAWFLTDWMIARRAETYRDL
FT                   GFDDPRSPWEIRVLCLLPIANIVGIPLLLLELAKIENRWYRQYRNIMWWTVLWAATWLL
FT                   ALVTWVVRDSVTVQGIADNALFTAIDYAVAAVAAWRLRRVYEGFTAPEGHHRAVRWLAV
FT                   ESPQGPVPLDADRPDVPPTRDANSGAAVEPVGTEPAALDRDRVVGAW"
     atgatccagg tgtgctcccg ctgcgggacc cagtggaacg tgcgtgagca gcgtcgatac        60
     tggtgcccac gatgccgggg cactctgctt gagccgggca tgaccgcccc gccgcggccc       120
     gccgcgtcca tgtcacgccc gcccgtcggg gcacccgcgc ccgccggcaa gtattgggtt       180
     ccgccgactc agcagggccc cgtggcaacg cctgcgggac gtccacaggc gcgtcccacc       240
     cggctgcccg cgggatatcg atggattgcc gtgcgtcccg gatcgccccc ggcgccggcc       300
     cgccgacgtc gtccgctcgg gccgacgccg cgctacgcgt atatccctcg ctggggtctg       360
     gtcgaccaca tcgagccgac cggatcgtca cgccaaggga tagccggggg tgctgtcccc       420
     agccggatac tcgacaggct cctgctggcc acaatcatca ccctggcaat cacttcatgt       480
     acgcattttc ttcgatatgc gttgatggtc tacaaccgcg gtgcactgat cccgcggttc       540
     gtcgccagtg cgtcaaacgg gctagtcctg atcagcgtgg cgcttgcctt cgcggttatg       600
     gcggccaccg cgtggttcct gacggactgg atgatcgcgc gccgtgcaga aacctatcgt       660
     gacctggggt tcgacgatcc gcgcagccca tgggagattc gggtgctgtg cctgctaccg       720
     atcgcgaaca tcgtgggtat accgctactt ctcctggagc tcgccaagat cgagaaccgt       780
     tggtatcggc agtaccggaa cattatgtgg tggacggttc tgtgggcggc gacgtggctg       840
     ctggccctgg tgacgtgggt ggtccgcgat tcggtgacag tgcagggcat cgcggacaac       900
     gcgctcttca cggccatcga ttacgcggtc gcggcggtcg cggcctggag gcttcgtcgc       960
     gtgtacgagg gcttcacagc accggaagga catcaccgcg cggtgcgctg gctggcggtg      1020
     gaatccccgc aggggccggt gccgctggat gccgaccgtc cggacgtgcc gccgacacgc      1080
     gacgccaatt ccggcgctgc ggttgaacca gtgggcacgg aaccggcagc attggatcgt      1140
     gaccgagtcg tcggagcctg gtga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page