(data stored in ACNUC30630 zone)

EMBL: CU458896.PE128

CU458896.PE128       Location/Qualifiers
FT   CDS_pept        complement(128625..129410)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0131c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q25ZC5_MYCVN 6e-68"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0131c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60231"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEG7"
FT                   /protein_id="CAM60231.1"
FT                   /translation="MTAAPPTTAERVRSACARAASSTLAVAGADVVGTSLHHLFDDGTF
FT                   AVAVPSDSAIAATVVAAGSAGMPALLELTDQAPLPLREPVRSLVWVRGNVVAASDREAR
FT                   GIVDVIASRIPDPALLDIRTDMRLRTEPGSVLLCLTVESVVVADSTGAESVDVSALLSA
FT                   RPDPFCALEAGWLSHIDHDHRDLVERLARRLPLNLQHGEVRLLGIDRYGIQLRVEGAES
FT                   DHDVRLPFNEPVNDTAGLSQALRILAGCPFLNGLRARKI"
     atgactgcag caccgcccac caccgccgag cgcgtgcgct cggcttgcgc acgggccgcg        60
     agctcgaccc tcgccgtcgc tggagccgac gtggtcggga cctcactgca ccacctgttc       120
     gacgacggca ccttcgccgt cgcggtcccc tccgatagcg ccatcgcggc gacggtggtc       180
     gcggcaggct ccgcgggcat gcccgcgctg ttggaactca cggatcaagc gccgcttccg       240
     ctgcgcgaac cggtcagatc gctggtctgg gtgcgcggca acgtggtagc cgcctccgac       300
     cgggaagccc gcggcatcgt cgatgtcatc gccagccgca tccccgaccc cgccctactg       360
     gacatccgca ccgatatgcg actacgcacc gagccgggct cggtactgct gtgtctgacc       420
     gtggaatccg tcgtcgtcgc cgattccacg ggagccgaat cggtggacgt ctcggccctg       480
     ctgagcgcgc gcccggatcc cttctgtgcg ctcgaggcgg gatggctctc ccatatcgac       540
     cacgaccacc gcgatctggt cgagcggctg gccaggcggt tgccactgaa cttgcaacac       600
     ggggaggtac gcctgctcgg catcgaccgc tacggcatcc agctgcgcgt ggagggtgcc       660
     gagagcgatc acgatgtacg gctgccgttc aatgagcccg tcaacgacac cgccggactg       720
     agccaagccc tgcgcatcct ggcaggctgc ccgttcctca acgggctacg cgcccgcaag       780
     atctag                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page