(data stored in ACNUC30630 zone)

EMBL: CU458896.PE149

CU458896.PE149       Location/Qualifiers
FT   CDS_pept        148859..149305
FT                   /transl_table=11
FT                   /locus_tag="MAB_0152"
FT                   /product="Putative ankyrin-like protein"
FT                   /note="Similar to Q827J2_STRAW 8e-39"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60252"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEI8"
FT                   /protein_id="CAM60252.1"
FT                   /translation="MTTMEPDRDNPDDQAGEAEHQARVAEQVAALAHELFNMAREGNAS
FT                   TLAAYLDAGAPVDLTNEAGDTLVMLAAYHGNASTVRSLVARGADVNRANDKGQTPLAGA
FT                   VFKGSDDIVQILVNAGADPAAGTPSALDAARMFGKDGYLSLFGA"
     gtgacaacga tggaacctga ccgtgacaac ccggacgacc aggcggggga agccgaacat        60
     caggcccgcg ttgccgagca ggtcgcagcg ctggcccatg aactgttcaa catggcccgg       120
     gagggtaacg cgtccaccct ggccgcctac ctcgacgcgg gcgcaccggt ggatctgacg       180
     aatgaggcgg gtgacacgct cgtcatgctg gccgcgtacc acggaaacgc ctcgacggtg       240
     cgatcgctgg tagcgcgcgg agccgacgtg aaccgggcca atgacaaggg gcagacgccg       300
     ctggctggag cggtgttcaa gggctccgac gacatcgtcc agatcctggt caatgcgggc       360
     gccgaccccg ccgcgggcac gccgtctgcg ctcgacgccg cgcggatgtt cggcaaggac       420
     gggtatctga gcctgttcgg tgcctaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page