(data stored in ACNUC30630 zone)

EMBL: CU458896.PE159

CU458896.PE159       Location/Qualifiers
FT   CDS_pept        complement(157190..157753)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0162c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q5YQC2_NOCFA 1e-25"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0162c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60262"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEJ8"
FT                   /protein_id="CAM60262.1"
FT                   /translation="MRPTTRRFLLLVALVATLVVVGGSAVGVYRSRTATPPFPVVDTVA
FT                   LSPGRAAVVRILGEEYAAQAGMAKYSEGNDEPWCADFTSWVMRASGKPFSNPNSGHWRI
FT                   PGVLTLTAYLRDAGRYETPSYAPEPGDMVLYDKPSPKGQHVNIVLINDKGTLTTVGGGE
FT                   GRGVGLSTYVAADDSGITGYGRYE"
     atgcgtccca ccactcgccg gttcctgctg ctggtagccc ttgtcgcaac cctcgtcgtg        60
     gtgggcggta gcgccgtcgg cgtctaccgt tctcgcacgg caacgccgcc atttcctgtc       120
     gtcgacaccg tcgcactgtc cccgggacgt gccgcggtgg tgcgcatcct cggggaggaa       180
     tacgccgccc aggccgggat ggcgaagtat tccgagggca acgacgagcc ctggtgcgcc       240
     gatttcacca gctgggtgat gcgcgcttcg ggcaagccgt tctccaatcc caactccgga       300
     cattggcgca tccccggcgt gttgacgctg accgcgtacc tcagggacgc gggacgctac       360
     gagactccca gctacgcacc agaacccggc gacatggtgc tgtacgacaa accgagtccc       420
     aaggggcagc atgtgaacat cgtgctcatc aacgacaaag gcaccctcac caccgtcggt       480
     ggcggggaag gccgcggcgt gggtttatct acctacgtgg ccgccgacga ttccgggatc       540
     accggatacg gccgctacga gtga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page