(data stored in ACNUC30630 zone)

EMBL: CU458896.PE171

CU458896.PE171       Location/Qualifiers
FT   CDS_pept        169498..171483
FT                   /transl_table=11
FT                   /locus_tag="MAB_0174"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q7D4U7_MYCTU 0.0"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60274"
FT                   /db_xref="GOA:B1MEL0"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEL0"
FT                   /protein_id="CAM60274.1"
FT                   /translation="MGPSNGLTRFTVWVSVLTVTVLFGWGAWQRRWIADDGLIVLRTVR
FT                   NLLAGNGPVFNKGERVEANTSTLWTYLTYLGGWAGGGMRLEYVALTLSLVLSLVGVALA
FT                   ILGTARLYAPLLAGRAAVMVPAGMLVYIAIPPARDFATSGLENGLVLAYLGGLWLMMVK
FT                   WAQAVRTPVTLDRRGGPHQPVDPRIVHAQRDQRDVLSRRFTVGLAFLAGLSVLIRPELA
FT                   LIGGGFLVMMLVAARGFMSRIWIVVAGGALPVLYQIFRMGYYGLLVPSTAIAKDASGSK
FT                   WGQGFVYLQNMNSPYLIWIPAVLLIALGVAAYQARRGQWWVRQVAAPGYGWLARLVQNP
FT                   TAVVVFMLVSGFVQGVYWIRQGGDFMHARVLLTPVFCMLLPISVVPLAAPDSAAFTPKK
FT                   ARLLTAATIGLFAGIAGWSVWVANSPGMAGDGTKVTYSGIVDERRFYAQATGVAHPLTA
FT                   ADYLNYPRMRAVLVAIDNTPDGALLLPSGNYDQWDVAPAIPPPPPIPHGYRGPHAVLFT
FT                   NLGMLGMNLGLDVRIVDQIGLANPLAAHTARITDGRIGHDKNLFPDWMIADGPWLKRYP
FT                   YIPRYIDQDWVAEAVEALKCPQTDAMLSAVRKPLSPRLFVSNMLHSYEFTTYRIDRVPR
FT                   FELARCGLPMPKLDTPSYTGLPATGP"
     gtgggcccca gtaatgggct gactcgcttc acggtgtggg tcagcgtcct caccgtgacc        60
     gtgctgttcg ggtggggcgc ctggcagcgg cgctggatcg ccgatgacgg gctcatcgtg       120
     ctgcgcaccg tgcgaaatct gctggcgggc aacgggcccg tcttcaacaa gggagagcgc       180
     gtagaggcca atacctccac gctgtggaca tacctgacct atctgggcgg ttgggccggg       240
     ggcggcatgc gcctggaata cgtggcgctg accttgtcac tggtcctgag cctggtgggt       300
     gtggccttgg ccatcctggg caccgcccgg ctgtacgctc ctcttcttgc cgggcgtgcg       360
     gccgtgatgg ttccagcggg gatgctggtg tacatcgcga tcccgccggc gcgtgacttc       420
     gccacctccg gcctcgaaaa cggtttggtg ctggcgtatt tgggtgggct gtggctcatg       480
     atggtgaagt gggcgcaggc cgtgcgcacg ccggtgaccc ttgatcggcg cggtggccca       540
     caccagccgg tggatccgcg gatcgttcac gcccagagag atcagcggga cgttctcagc       600
     aggcgattca cggtggggct ggccttcctc gccggcctga gcgtgctgat tcgcccggag       660
     ctggcgctca tcggcggcgg cttcctggtg atgatgctgg ttgccgcccg cggattcatg       720
     agccggatat ggatcgtggt cgccggtggc gcactgcccg tgctctacca gattttccgg       780
     atgggctact acggcctctt ggtgcccagc acagcgatcg ccaaggatgc ctcgggttcc       840
     aagtgggggc aggggttcgt ctacctgcag aacatgaact ccccgtacct gatctggatt       900
     ccggcggtat tgctcatcgc gctgggtgtg gccgcctacc aggcccgccg cgggcagtgg       960
     tgggtgcggc aggtggcggc tcccggttac ggctggttgg ctcgcctcgt gcaaaaccct      1020
     acggccgtcg tcgttttcat gctcgtgagc ggatttgttc agggtgtgta ctggatccgc      1080
     cagggtgggg acttcatgca cgcccgggtg ttgttgaccc ccgtgttctg catgttgctt      1140
     ccgatctcgg tggttccgct ggcagctccc gatagcgcgg ccttcacccc caagaaggcg      1200
     cgtctgctca cagcggccac catcgggttg ttcgccggta tcgcgggctg gtccgtctgg      1260
     gtggccaact cgccgggcat ggcaggtgac ggcaccaagg tcacctatag cggcatcgtc      1320
     gatgagcgcc gtttctacgc gcaggccaca ggtgtcgccc acccgctgac cgcagcggac      1380
     tatctcaact acccccgcat gcgggcggtg ctggtggcga tcgacaacac ccccgacggc      1440
     gcgctgttac ttccatcggg gaactacgac caatgggatg tggcaccggc gatcccgcca      1500
     ccgccgccga tcccgcacgg gtaccgcgga ccacatgcgg tgctgttcac caacctgggc      1560
     atgctcggca tgaacctggg cctggacgta cggatcgtgg atcagatcgg tttggctaac      1620
     ccgctggccg cgcataccgc gcgtatcacc gatgggcgca tcggccacga caaaaacctg      1680
     ttcccggact ggatgatcgc cgacgggccg tggctcaagc gttatcccta tatccccagg      1740
     tacatcgatc aagactgggt ggccgaggcc gtcgaggcgc tgaaatgtcc gcagaccgac      1800
     gccatgctca gtgcggtgcg caaaccgttg tcgccgcggt tgttcgtgtc caacatgctg      1860
     cactcctatg agttcacgac ctatcggatc gatcgtgtgc cgcgctttga actggcgcga      1920
     tgcggtctgc cgatgccgaa gctggacact ccttcgtaca ccgggctgcc ggcaaccggt      1980
     ccgtag                                                                 1986
//

If you have problems or comments...

PBIL Back to PBIL home page