(data stored in ACNUC30630 zone)

EMBL: CU458896.PE198

CU458896.PE198       Location/Qualifiers
FT   CDS_pept        complement(211043..211930)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0201c"
FT                   /product="Probable O-antigen/lipopolysaccharide transport
FT                   integral membrane protein ABC transporter RfbD"
FT                   /note="Similar to Q25Z80_MYCVN e-114"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0201c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60301"
FT                   /db_xref="GOA:B1MEN7"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEN7"
FT                   /protein_id="CAM60301.1"
FT                   /translation="MSSSAGLTSQRPGSKENDMANELIELSSDSRTFKRAWRDLSEGFE
FT                   HRQLWLQLGWQDIKQRYRRSVLGPFWITIATGSTALAMGILYSQLFKLPLAEHLPYVTI
FT                   GLIVWNLFNAAILEGSDVFVANEGLIKQLPTPLSVHVYRLVWRQLLLFAHNIIIFLIVV
FT                   AVYTPHWHFTDLSFIPALVLITLNCLWVSLVFGVLATRYRDISPLLGSLVQLLFFMTPI
FT                   IWNENMLNQRVGKLATVVQLNPFVHFLAIIRDPLLGLDQQLHHWIIALSITVVGWIVAI
FT                   VVMRQYRARVPYWV"
     gtgagcagtt cggccggcct gacaagccag cgcccagggt cgaaggagaa tgacatggcg        60
     aacgaactga tcgaactatc atcggactcc cgtaccttca agcgcgcatg gcgtgacctg       120
     tcagagggtt tcgagcatcg gcagctctgg ttacagctcg gctggcagga catcaagcag       180
     cgctatcggc gttcggtgct gggaccgttc tggatcacca tcgccaccgg atcgacagcg       240
     ctggccatgg gcatcctgta ctcgcaactg ttcaagctgc cgctggctga acatctgcct       300
     tacgtgacaa tcggtttgat cgtctggaac ctcttcaacg cggcgatcct cgagggttcg       360
     gacgtcttcg tcgcgaatga gggcctgatc aaacagctcc cgactcctct gagtgtgcac       420
     gtctatcggc tggtctggcg acagctgctg ctgttcgcgc acaacatcat cattttcctg       480
     atcgtggtcg cggtatacac gccgcattgg catttcaccg atctcagttt catccccgcg       540
     ctggtgttga tcacgctgaa ttgcctgtgg gtttccctgg ttttcggcgt gctggccacc       600
     cgctatcggg atatctcacc gctgttgggc agcctggtgc aactgctgtt cttcatgacg       660
     ccgatcatct ggaacgagaa catgctcaac cagcgggtgg gcaagttggc caccgtggtg       720
     cagctcaacc cgtttgtgca cttccttgcc atcatccgtg acccgctgct ggggcttgat       780
     cagcagctgc accactggat catcgcgctg tcgatcacgg tggtcggttg gatcgttgcg       840
     atcgtggtga tgcgccagta tcgggccagg gtcccgtatt gggtttag                    888
//

If you have problems or comments...

PBIL Back to PBIL home page