(data stored in ACNUC30630 zone)

EMBL: CU458896.PE200

CU458896.PE200       Location/Qualifiers
FT   CDS_pept        complement(212809..213600)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0203c"
FT                   /product="Probable o-antigen/lipopolysaccharide transport
FT                   ATP-binding protein ABC transporter RfbE"
FT                   /note="Similar to Q5Z3D1_NOCFA e-125"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0203c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60303"
FT                   /db_xref="GOA:B1MEN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEN9"
FT                   /protein_id="CAM60303.1"
FT                   /translation="MVSIQTHQAWVEFPIFDAKSRSLKKAFLGKAGGAIGRNESNVVVI
FT                   EALRDITLSLKEGDRVGLVGHNGAGKSTLLRLLSGIYEPTRGSSYIKGRVAPVFDLGVG
FT                   MDPEISGYENIIIRGMFLGQTRKQMQAKVDEIADFTELGEYLSMPLRTYSTGMRVRLAM
FT                   GVVTSIDPEILLLDEGIGAVDAEFMKKARIRLQQLVERSGMLVFASHSNEFLARLCNTA
FT                   MWIDHGTIKMSGGIEDVVRAYEGDEAGDHVAQILAEDAHDG"
     atggtcagta tccaaactca ccaggcgtgg gtggaattcc ccatattcga cgccaagtca        60
     cgctcgctca agaaggcgtt cctgggcaag gcgggcggcg ccatcgggcg caacgagtcc       120
     aatgtcgtgg tcatcgaggc cctgcgtgac atcacgctgt ccctcaagga gggcgaccgc       180
     gttgggctcg tcggccacaa cggcgcgggt aaatcgactc tgctgcggct cctttcggga       240
     atctacgaac ccacgcgggg cagctcctac atcaagggcc gcgtcgcacc cgtgttcgac       300
     ctgggcgtgg gtatggatcc ggaaatctcc gggtacgaga acatcatcat ccgcggcatg       360
     ttcctgggac agacccgcaa gcaaatgcaa gccaaggtcg acgagatcgc cgacttcacc       420
     gagctcggcg agtacctgtc catgccgctg cgtacgtatt ccaccggtat gcgcgtgcgc       480
     ctggccatgg gcgtggtcac cagcatcgac cccgagatcc tgctactcga tgagggcatc       540
     ggtgccgtcg acgcagagtt catgaagaag gcgcgaatcc ggttgcagca gttggtagag       600
     cgctccggca tgctggtctt cgccagccac tccaatgagt tcttggcccg gctgtgcaac       660
     acggcgatgt ggatcgacca cggcaccatc aagatgagcg gcggcatcga ggacgtggtc       720
     cgtgcctacg aaggcgatga ggccggagat cacgtggccc agatccttgc cgaagacgcg       780
     cacgatggct ag                                                           792
//

If you have problems or comments...

PBIL Back to PBIL home page