(data stored in ACNUC30630 zone)

EMBL: CU458896.PE206

CU458896.PE206       Location/Qualifiers
FT   CDS_pept        219659..223093
FT                   /transl_table=11
FT                   /locus_tag="MAB_0209"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60309"
FT                   /db_xref="GOA:B1MEP5"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEP5"
FT                   /protein_id="CAM60309.1"
FT                   /translation="MTDCRDLVRPAAAAQRLPSGDLDTSLVSGHERGRRAAAFASGGVL
FT                   VVGAVAALHNLYRSGDDAAELIAWSGLLLLALTALGGGIKLAMWGARPVIAALFDRAKE
FT                   RLAEPVLAVVASGAVIVGALGMWWTFRGGYAGWWQQLSGESQWSLSLGVGQMLVAVLAG
FT                   AALFTGGRYVTGLAREALTESGLLIERDRAAGRRRVPEGLWHPGLVAALVGGGLALVVM
FT                   TAWLTPKVGPTIVGANTLAAVAAIVAVLVWGVGANLGWWKGLAGLWKWATDASHKAAAT
FT                   SGVVALLMFSAGGLGLGWFTPATVPQAHAQCPPDCGGGSNGSGSYGPDASQFQPPQMPG
FT                   QMPDYQGGINQPPLDQNSSISIYNTQAPSVSNNGVQGSSGQQGPQQGWDQPAHGTQIPD
FT                   YQNAAPYTQGPGRPNPDFNPGSDAGSQGGQSNQGAQQPVQQPQQASQQPPQQDAGQQPN
FT                   QSPNQSSDQQKIDDLTRQLQDQQQLSSQDRQRIDDLTKQLQQGQQRQNGNQKLPKAPSR
FT                   DKKQDDKDQQDRDDQSGDNDLSALLLGAASTRRRKQDEQDLSDQQQPQGPDTQALAQDG
FT                   AQLGQSLPGDIANTVSDSVNLGQSAGSAAQNFGSAAQAGASLASSAQSGAVNPMDAVAL
FT                   VQGVSGGISDTADAVGSGASIASTWLNEAGQGAQLAADANPQLKAEAEQVRQLTQAGSQ
FT                   VADLTGKVAGGVSQVSGMVNTASSLGTSGMPDTSGATDALSGTATAVNGPGDVPKPPTP
FT                   PSVPSQSPSSVQALDSTTTRAPQQPPQPSNPSTPKTANQSSTSKPLSPLEASTFPAPLQ
FT                   ALNTAQAASTPDPNAGRLSSMPGVRDVSQPPLRPAPTLQPDQVDAFRAITRQNLENQNV
FT                   PADQIEQRVNDAVKQAQTPRFMPDPQPMRTPGAQPLDRPLGDKFNDVMGRANDRAYDDI
FT                   DGLGQLGKNLTGQGGPGAPGVAESWKDLGTNTVKGLPDAVGGGFVADGKRLYEEPGNFI
FT                   GDKMVELPLAAVSVPLGGEGAAIERGVLGDLASTETKAVTRGPVETPPVQLPAVDVPKP
FT                   RLADYFQPGSPPKASELEKYALSQGWKKSQTPSGPAKYSDNNGIVRMTIKEGSQRAPGS
FT                   ELPHVELRDPNGQRIDPFGNPVARKSPDNHTAIGWDW"
     gtgaccgact gccgtgatct ggtccgcccc gctgcggcgg cgcagaggtt gccgtctggc        60
     gatcttgaca cgtcacttgt gtcgggacat gagcgcggcc gacgtgctgc agctttcgct       120
     agcgggggcg ttctggttgt tggcgcggtc gcggcgctgc acaacctgta tcgcagcggt       180
     gacgatgctg ccgaactgat cgcttggtcc ggcctgttgt tgctggcgtt gaccgccctt       240
     ggtgggggaa tcaagcttgc gatgtggggt gcgcggccgg tcatcgccgc gttgttcgat       300
     cgggccaagg agcgtttggc ggagccggtg ttagcggtgg tcgcgtcggg ggcggtcatt       360
     gtcggcgcgt tgggtatgtg gtggacgttc cgcggcggat atgcgggttg gtggcagcag       420
     ctgtccggcg agagccagtg gtcactgtcg ctgggggttg gccagatgct ggtggcggtt       480
     cttgccggtg ctgcgctgtt cactggtggc cggtatgtga ccggtttggc cagggaggcg       540
     ctcaccgagt cgggtctgtt gatcgagcgt gatcgggcgg cgggcaggcg ccgggttccg       600
     gaggggttgt ggcatccggg tctggtggcc gcgcttgtcg gcggtgggtt ggcgctcgtg       660
     gtgatgacag cgtggctgac cccgaaagtg gggcccacca tcgtcggtgc caacacgctg       720
     gcggcggtcg ctgcgattgt cgcggtgttg gtttggggtg tgggggccaa tctggggtgg       780
     tggaaaggtc ttgcgggtct gtggaagtgg gctactgatg cttcgcataa ggcggccgcg       840
     acgtccggtg ttgttgcgtt gttgatgttc tcggcgggtg ggttgggttt gggttggttt       900
     actccggcca cggtgcccca agcgcatgcg cagtgtccgc cggattgtgg gggtggttcg       960
     aacgggtctg gttcgtatgg gccggatgct tcgcagtttc agccgccgca gatgcccggt      1020
     cagatgccgg attatcaggg tgggatcaat cagccgccgc tggatcaaaa cagctcgata      1080
     tcgatctata acacgcaggc tccgtcggtc agtaataacg gggttcaggg gtctagtggg      1140
     cagcaggggc ctcagcaggg ctgggatcag cccgcgcatg gcactcaaat cccggactat      1200
     cagaacgccg ccccgtatac gcaggggccg ggtaggccga atccggactt caacccggga      1260
     tctgatgcgg gatcgcaagg tgggcagtcg aatcagggcg cacagcagcc tgtgcaacaa      1320
     ccgcaacagg catcgcaaca accgccgcaa caagatgctg ggcagcagcc caaccaatcg      1380
     ccgaatcagt cctccgatca gcagaagatc gacgacttga cccggcagct gcaggatcag      1440
     cagcagctat ccagtcagga tcgtcaacgc attgatgatc tgaccaaaca gctgcagcag      1500
     ggtcagcaga ggcagaacgg caatcagaag ctgccgaaag ccccgtccag ggacaaaaag      1560
     caggacgaca aggaccagca ggatcgcgac gatcagtctg gtgacaatga tctgtcggcg      1620
     ttgttgttgg gtgcggcctc cacgcggcgc cgcaagcagg acgagcaaga cttgtctgac      1680
     caacaacagc cgcaaggccc cgatacccag gcgctggcgc aagatggtgc gcagctgggt      1740
     cagtcgctgc ccggcgatat cgccaatacc gtctctgaca gcgtgaattt ggggcagtcg      1800
     gcgggctcgg cggcacaaaa cttcggctcg gctgcccagg ccggggcctc gctggcttct      1860
     agcgctcagt cgggtgcggt taatccgatg gacgctgttg cgttggtaca aggggtttct      1920
     ggagggatca gcgataccgc tgatgcggtg ggctcgggtg cctcgattgc ctccacctgg      1980
     ctcaatgaag ccgggcaggg cgcacaactg gccgccgacg ccaacccgca gctcaaggcc      2040
     gaggccgagc aggttcggca gctcacccag gccggtagcc aagtcgccga cctgaccggc      2100
     aaggtcgcag gcggtgtctc ccaggtttcc gggatggtca acaccgcatc cagcctgggc      2160
     acatccggta tgcccgacac ctcaggggcc accgatgcac tctcggggac ggcgaccgct      2220
     gtcaacgggc ccggcgatgt ccccaaaccg cctacgccac cgtctgtgcc gtcgcaatcg      2280
     ccctcgagcg tgcaggcgct cgacagcacc accactcggg caccccagca gccgcctcag      2340
     ccgtctaacc cgtcgacacc gaagaccgcc aaccagagct caacctctaa gccgctatcg      2400
     ccgctagagg cttccacatt cccggcaccg ctgcaggccc tgaacacggc gcaggcggcc      2460
     agcacaccag atccgaatgc aggccgtttg tcatcgatgc ccggggtgcg tgacgtcagc      2520
     cagcccccgc tgcggccggc gccgacattg cagcctgatc aggtggacgc attcagggcc      2580
     atcacccgtc agaacctgga aaaccagaac gtacctgccg accagatcga gcaacgcgtc      2640
     aatgatgcgg ttaaacaagc acaaacccca cggttcatgc ctgaccccca accgatgcgc      2700
     acacccggcg cgcagccatt ggaccggccg cttggcgaca agttcaacga tgtcatgggc      2760
     cgcgccaatg atcgggccta cgacgacatc gacgggctag ggcaactcgg caaaaacctc      2820
     accggacaag gcggcccagg tgcacccggt gtcgctgaat cctggaaaga cctcggtacc      2880
     aacacagtca aggggcttcc cgacgcagtt ggcggcggct tcgtcgcgga cggtaaacgc      2940
     ctgtacgagg aacccggaaa cttcatcggc gacaagatgg tcgagctccc gcttgcggcc      3000
     gtatccgtgc ccctcggcgg cgaaggcgca gccatcgaac gcggcgtact aggcgacctt      3060
     gcctccaccg aaaccaaagc agtaaccagg ggcccagttg agacccctcc ggtacagctg      3120
     cctgctgtcg atgtgcccaa gccccgccta gccgactatt ttcagccagg cagtccgccg      3180
     aaggcgagtg aactagaaaa gtatgccctt tctcagggct ggaaaaaatc acagacgcca      3240
     agcggacccg caaaatattc ggacaataat ggtattgtgc gaatgacgat aaaagaggga      3300
     agtcaacgag caccaggtag tgagcttcct catgtggagc tccgtgatcc aaacggtcaa      3360
     cggattgatc catttgggaa tccggtggcg cgaaaaagcc cagacaacca tactgcaatt      3420
     ggatgggatt ggtaa                                                       3435
//

If you have problems or comments...

PBIL Back to PBIL home page