(data stored in ACNUC30630 zone)

EMBL: CU458896.PE213

CU458896.PE213       Location/Qualifiers
FT   CDS_pept        227341..227661
FT                   /transl_table=11
FT                   /locus_tag="MAB_0216"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q73WD7_MYCPA 1e-20"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60316"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B1MEQ2"
FT                   /protein_id="CAM60316.1"
FT                   /translation="MTALANAQAATARNAPSGRAAHTVHGGSGHALRQVIMALAARHKL
FT                   AEHENPGEATLLVLSGLVELATSTARATLAAGEYVVFPQERHELTAIEDSVVLLTVVSR
FT                   AG"
     atgacggccc tggcaaatgc acaggccgca acggcacgca acgcgcccag tggccgggcc        60
     gcacacaccg tgcacggcgg cagcggtcat gcgctccggc aggtgatcat ggcgcttgcc       120
     gccaggcaca agctggccga acatgaaaat cccggcgagg ccacactatt ggtgctcagc       180
     ggactggtcg agctggcgac gtcaaccgct agggccaccc tcgcggcggg agagtatgtg       240
     gtctttccgc aagagcgcca cgaacttaca gcgatcgagg attccgtggt actgctgacg       300
     gtggtgagcc gggcggggtg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page