(data stored in ACNUC30630 zone)

EMBL: CU458896.PE222

CU458896.PE222       Location/Qualifiers
FT   CDS_pept        235976..236137
FT                   /transl_table=11
FT                   /locus_tag="MAB_0225"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60325"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFC5"
FT                   /protein_id="CAM60325.1"
FT                   /translation="MRHLPQSEHCDLGLDPRADHTPDLRPEKELPPTSTAKHQVEGNQP
FT                   IPLRGIDL"
     atgcgccatc taccgcagtc cgaacactgc gacctcggcc tagatccacg ggccgatcac        60
     acaccggacc tacgcccgga aaaagaactg cccccgacca gcaccgccaa gcaccaggtc       120
     gagggcaacc aaccaattcc attgagagga atcgatctct aa                          162
//

If you have problems or comments...

PBIL Back to PBIL home page