(data stored in ACNUC30630 zone)

EMBL: CU458896.PE224

CU458896.PE224       Location/Qualifiers
FT   CDS_pept        236850..237158
FT                   /transl_table=11
FT                   /locus_tag="MAB_0227"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60327"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFC7"
FT                   /protein_id="CAM60327.1"
FT                   /translation="MTNLGSMPTQALHDELFKRIIANYEHAKIPCQYRNLGCRRPAKWL
FT                   WIRKHSHGGERFTLCGRHKNYWRRGVNTLIAVQGYYKCPGCETRYHSADEVASVRRL"
     atgacgaact taggcagcat gcccacacag gctcttcatg atgagttgtt caaacgcatc        60
     atcgcgaact acgagcacgc caagatccct tgccaataca ggaatctcgg gtgccgtcgc       120
     ccggcaaagt ggttgtggat tcggaagcac tcacacggtg gcgagcggtt caccctctgt       180
     ggtcgccaca agaactattg gcgccgaggg gtaaacacgc tcatcgccgt ccagggctac       240
     tacaagtgcc cggggtgcga gacgcggtac cacagcgccg atgaggtcgc gtctgtgagg       300
     cggctctga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page