(data stored in ACNUC30630 zone)

EMBL: CU458896.PE227

CU458896.PE227       Location/Qualifiers
FT   CDS_pept        237901..238659
FT                   /transl_table=11
FT                   /locus_tag="MAB_0230"
FT                   /product="Hypothetical protein"
FT                   /note="No similarity found (10-5)"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60330"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFD0"
FT                   /protein_id="CAM60330.1"
FT                   /translation="MSEVAVLEQGADVEVVVPMDRRSAERLDQRIRQVAGTVRDNFVKL
FT                   AAFVEEAKAGNIHEVLGFASWTAYLADALGGQLEVRGPVRLEVVQFLAGEGMSTRGIAA
FT                   ITGASKSTIANDLAQVSNSGHVDSDGDQSAVPNGTPADEQKTVGLDGKEYRKPKPRKKP
FT                   EPKPVEETAQTEDTPPARAVQIPTAIRQLTVKLKGATDELTALTYDKRWDKALGRLTDA
FT                   DAEALQTIAVTIADIHAGIATALARTEEEV"
     atgagtgaag tagcagtact agagcagggt gccgacgttg aggtcgtcgt acctatggac        60
     cggcgttcag cagaacgact agatcagcgc atccgtcagg ttgccgggac agtcagggac       120
     aacttcgtga agctggccgc gttcgtggaa gaggctaagg ctggaaatat ccatgaggta       180
     cttgggttcg ccagttggac agcgtatctc gccgacgccc tcggtggtca gctggaagtg       240
     cgcgggccgg tgcgtctgga ggtcgtgcag ttcctagccg gtgaagggat gagtacacgc       300
     ggtatagctg cgatcaccgg ggcgtcgaag tccactatcg cgaatgacct tgcgcaggtg       360
     tccaattctg gacacgtgga ttcggacggc gatcaatcag ctgtcccaaa tgggacacct       420
     gccgatgagc agaagacggt cgggctagac ggcaaggaat accggaagcc caagccgcgt       480
     aagaagccag agcccaagcc agtagaggag accgcacaaa ccgaggacac tcccccggca       540
     cgtgcagtcc aaatacccac cgctatacgg cagctcacgg tgaagctcaa gggcgcgacg       600
     gacgaactca cggcactgac ctacgacaag cgttgggaca aggcgttagg ccgtctcacc       660
     gatgcggacg ccgaagcact gcagaccatc gcagtcacca tcgccgacat acacgcgggc       720
     atcgcaaccg ccctggcccg gacagaggag gaggtgtga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page