(data stored in ACNUC30630 zone)

EMBL: CU458896.PE23

CU458896.PE23        Location/Qualifiers
FT   CDS_pept        complement(24439..24843)
FT                   /transl_table=11
FT                   /locus_tag="MAB_0024c"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q279L4_MYCFV 5e-15"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0024c"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60126"
FT                   /db_xref="GOA:B1ME62"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/TrEMBL:B1ME62"
FT                   /protein_id="CAM60126.1"
FT                   /translation="MSLLTKSEEPAVKLTSGQRLARGLKEAALAPIDVSRGTAGLSFGL
FT                   AKSATSAAGRLLRRGKAVSSEVQDAVADVVDTLPEVVSGARKRKLPRALTGLAVVGLLG
FT                   AGAVAFSVLRRSGQPEPSPLAPSVDPQPQP"
     atgagcctgc tgaccaagtc cgaagaaccc gccgtcaagc tgacctccgg tcagcgtctg        60
     gcccgggggc tcaaggaagc ggccctggca ccgatcgacg tgtcacgcgg taccgccggg       120
     ctcagcttcg gcctggccaa atcggcgacc agcgccgcgg gccggctgct ccgtcggggc       180
     aaggccgtct catcagaggt gcaggacgcc gtcgccgacg ttgtcgacac cctccctgag       240
     gtggtcagcg gcgcccgcaa gcgcaagctg ccccgcgcac tgaccggcct tgccgtcgta       300
     gggctgctgg gcgctggcgc tgtggcgttc agcgtgctgc ggcgctctgg gcaacccgag       360
     ccgtcaccgc tggcaccgag cgtggatccg caaccgcaac cgtaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page