(data stored in ACNUC30630 zone)

EMBL: CU458896.PE230

CU458896.PE230       Location/Qualifiers
FT   CDS_pept        239529..243512
FT                   /transl_table=11
FT                   /locus_tag="MAB_0233"
FT                   /product="Putative phage tail tape measure protein TMP"
FT                   /note="Similar to Q5YZK8_NOCFA 6e-96"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60333"
FT                   /db_xref="GOA:B1MFD3"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFD3"
FT                   /protein_id="CAM60333.1"
FT                   /translation="MAVELASGYVSLSVRVGATSGLGKLFDNAQKQATSAGKKTGEAFA
FT                   KALASEAKAAEEQVKKLTDTVTKSRDKEADQAGKLKVALEKLNEARQGGVSGSKLTALE
FT                   ESHAAALRKQQAAAQDLAKDLDAVTRAQRRATDAQAAVGRAPKNVQNRVSQLLSGSADA
FT                   AGHAGGLAGRRFGDSFSGALRSTGIVAAGTAVGNLAANAMTKAASFATSGVSAVVTKGL
FT                   DFEKTMNTLSGVTGASADVMQRFRDTAKALGNDMTLSNTSAADAAQAMTELAKAGFSVD
FT                   ESIAGAKGTLQLAAAAQVDAGKAAEIQANALLAFGLKADYASKAADVLSNAANASSAEI
FT                   TDVAQALQSGGAVANQFGLKLEDTAAAIGLLANNGIKGSDAGTLLKSALLALTDTSNPA
FT                   QGAIEELGLTVYDAQGRFVGLEKLFGDLQAASQRMTPEMYQAATTTLFGSDAARLAGIA
FT                   AKDGAAGYDQMRDAMEKQGSAAKLAAAQNQGLPGVIERLKNAAETLAITLFEKVQGPLS
FT                   SIGDGLTGFTNKMQDAFENPAVSQAAGAIGAALSGIGAAFGRILSAVGPALVGGLSNAV
FT                   NLIVRFKDFLIPLVAGLVAYKTVMLAITVATKAWAAVQALLNIALTANPIGLIIAAIAG
FT                   LVAGIVVLYNRNETFRKIVQTTWAAIKTAISAVWNWLSTTVFPGLKLAFTAIGTAATWL
FT                   WNNAITPAWNGIKAVIGVAWEVVSDIFNNWVRVGQLVGQGAMWLWNNAIQPAWDGIKNA
FT                   ISAAWDFVSPILDKFSAGWDALKSGISSASSAIKDAVTSAFSGLAAVIKAPLKLLGTFL
FT                   ASIPSEVFGFQIPGADKLNSWGKSLQGFAAGGLVRGPGSGTSDSILAWLSNGEGVVTAK
FT                   GMKHGAGIVAALNSGWVPSPAYLADMMRAPGYAEGLNPGADYLRSLVMRMWPQIKSIGG
FT                   RRSEDGFGEHSTGNAIDIMIPNYQTPQGMALGNAIAAFLANNASALDLNGFIWRRQSYG
FT                   YGGSFTSGTPMDDRGDDNKNHMNHVHVILGSGRGSGAAAVGLPTSNISLPSGGSVAARA
FT                   MGNTGSSGGSSKQAREADDRITDLSNRLDVTEQELADLESNPKAKETTKQRKRDMVDKL
FT                   KRDLQQAKDDRASLDLGGSSGGFGGGNNPYAKIMEGISEILPDFGGLADIGIGGLKESL
FT                   LPPGFSDPMQWGFMQAGSTLLKFFGGLRNVSDGKPLLGEGGALMANITGAAMSGSGSGI
FT                   VDAIKTIIPAPFGSMDAAQLQGAPGDINPVIAGAQIPGTGFGDMGSAFSQGSAAPNGNG
FT                   SPVDQSINFNAPVGTGVDQAMQKAQSAQNQQYRRNNGTRTMPS"
     atggcagttg aactcgcatc agggtatgtg tccctgtcgg ttagggtcgg ggccacctcg        60
     ggtttgggca agctctttga taacgcgcag aagcaagcca cgagcgcagg taagaagacc       120
     ggcgaagcct tcgccaaagc tcttgcttcc gaagcgaaag ccgccgagga gcaggtaaag       180
     aagctcaccg acaccgtaac caagtctcgg gacaaagaag ctgaccaggc aggcaagctc       240
     aaggtagcgc tggaaaagct caacgaggcc cgccagggcg gtgtctcagg gtcgaaactc       300
     accgccctgg aggaatccca cgccgccgcg ctacgcaagc aacaggccgc cgcacaggat       360
     ctagccaagg atctagatgc tgtcacccgc gcacagaggc gggccaccga tgctcaagcc       420
     gccgtggggc gcgcgccgaa gaatgttcag aaccgtgtct cgcagctgct ctccggctct       480
     gctgatgcag cggggcacgc cgggggttta gccggtcgca ggttcggtga ttcattctct       540
     ggcgctttgc gttccacagg cattgtggca gccggtacag cagtgggaaa cctggccgcc       600
     aatgcgatga ccaaggctgc cagtttcgcc accagcggag tttccgcggt ggtgactaag       660
     ggtctggact tcgagaagac catgaacacc ctctcgggtg tcacaggtgc ttcggcagac       720
     gtgatgcagc ggttccgcga caccgccaag gccctcggca acgacatgac gttgtcgaac       780
     acctcggctg ctgatgctgc acaggccatg accgaactcg ccaaggccgg tttctcagtg       840
     gatgagtcga ttgccggcgc caagggcacc ctgcagctgg ccgctgctgc gcaagtcgat       900
     gcgggcaagg ctgccgagat tcaagccaac gccctgttgg ccttcggtct caaagccgac       960
     tacgcctcta aggccgcaga tgtgttgtcg aatgcggcca acgcatcctc ggcggaaatc      1020
     accgacgtgg cacaggcatt gcagtccggt ggcgcggtcg ccaaccagtt cggcctcaag      1080
     ctcgaagaca ccgccgccgc gatcggcctg ctggccaaca acggcatcaa aggctccgat      1140
     gccggaaccc tgctcaagtc cgcgctgctg gcactgacgg acaccagcaa cccggcacaa      1200
     ggcgctattg aagagctcgg tctgaccgtc tatgacgccc aaggccgatt cgtggggctg      1260
     gagaagctat tcggggactt gcaggccgcc tcccagcgga tgacaccaga gatgtaccag      1320
     gcggccacca caaccctgtt cggctccgat gcggcccgcc tggccggcat cgccgccaag      1380
     gacggtgccg ctggatatga ccagatgcgc gacgccatgg aaaagcaagg ctcggctgcc      1440
     aagctcgccg cagcgcagaa ccaaggacta ccgggggtca ttgaacggct aaagaacgcc      1500
     gccgaaaccc tggccatcac cctgtttgag aaggtccaag gcccgttgtc gagcatcggg      1560
     gacggactga ccgggtttac caacaagatg caggacgctt tcgagaaccc tgccgtaagc      1620
     caggcagccg gggctatcgg tgccgccctg tccggtatcg gggccgcgtt cggacggatc      1680
     ctgtcagccg tgggtccggc gttggtgggc gggttgtcga acgctgtcaa cctgatcgtc      1740
     cgcttcaaag acttcctaat ccctctcgtc gccggtctag ttgcttacaa gacggtgatg      1800
     ctcgctatca ccgtggccac gaaagcgtgg gccgcagtcc aagccctgct gaatatcgct      1860
     ttgaccgcca acccaattgg tttgatcatc gccgccatcg caggtttggt cgccggaatc      1920
     gtagtgctat acaaccgcaa cgagacattc cgaaagattg tccaaaccac ttgggcggca      1980
     ataaagacag cgatatcggc agtgtggaat tggctatcga ccaccgtatt ccccggcctg      2040
     aaactggcat tcaccgctat cgggaccgcc gccacctggt tgtggaataa cgcgataacc      2100
     ccggcctgga atggcatcaa agccgtcatc ggtgtcgcgt gggaggttgt ctccgacatc      2160
     ttcaacaact gggtgcgggt cggccagctc gtcggacaag gtgcaatgtg gttgtggaac      2220
     aacgcaatcc aaccggcatg ggacggaatc aagaacgcga tcagcgccgc gtgggacttt      2280
     gtatcgccca ttctcgataa gttctccgcc ggatgggatg cactcaagtc cggcatttcc      2340
     agcgcctcca gcgcgatcaa agatgctgtc acatccgcat tctcgggact agccgcagtc      2400
     atcaaagcgc ccctgaaatt gctgggcaca ttccttgcct ctatcccgtc tgaggtattc      2460
     gggttccaga tccccggcgc agacaaactc aactcgtggg gtaaatccct acagggcttc      2520
     gccgcaggcg gattggtgcg cggacccggc tcgggtactt ctgattccat cctggcgtgg      2580
     ctatccaacg gcgaaggagt ggtcaccgcc aagggaatga agcacggcgc gggaatcgtc      2640
     gcggccctga actcaggctg ggtgccatcg cccgcatacc tggccgacat gatgcgcgcc      2700
     cccggatatg ccgagggcct gaatcccggc gcggactatc tgcggtccct ggtgatgcgg      2760
     atgtggccgc agatcaaatc catcggcggc aggcgctccg aggacggctt tggcgagcac      2820
     tccacgggga acgcgattga catcatgatt ccgaactacc aaaccccgca aggtatggcg      2880
     ctcggaaacg caatcgcagc tttcctggcc aacaacgcca gcgccctaga cctcaacgga      2940
     ttcatctggc gtcggcaaag ttacggctac ggcggttcgt tcactagcgg caccccaatg      3000
     gatgatcgcg gcgacgacaa caagaaccac atgaaccacg tgcacgtgat tctgggctct      3060
     ggcagaggat ctggcgccgc agcggtagga ctaccgacaa gcaacatctc tctgccgtcc      3120
     ggtgggtccg tggccgcacg agcgatgggc aacaccggat cttccggcgg ctcatcgaaa      3180
     caggcccgcg aggccgatga ccggatcacg gacctgtcga accggctcga tgtcaccgag      3240
     caggaattgg ccgacctgga gtccaacccg aaggctaaag agaccaccaa gcagcgcaag      3300
     cgtgacatgg tcgacaagct caagcgcgac ctgcagcagg ccaaggatga tcgggcatcg      3360
     ctagacctgg gtggttccag tggtggattc ggtggcggca acaacccgta cgccaagatc      3420
     atggagggaa tctccgagat cttgccggac ttcggcggcc tggccgacat tggtatcggt      3480
     gggctcaagg aatcgcttct gcctccaggg ttctcggacc cgatgcagtg gggctttatg      3540
     caagccggtt cgaccctgct gaagttcttc gggggcctgc gcaacgtctc cgatgggaaa      3600
     cccctacttg gtgagggcgg ggcgctcatg gccaacatca ccggcgctgc gatgtccggg      3660
     tctggcagcg gaatcgtcga cgcgatcaag acaatcattc cggctccgtt cggcagcatg      3720
     gacgccgctc aactccaagg ggcaccaggc gatatcaatc ccgttatcgc gggtgctcaa      3780
     atccccggca ccggattcgg cgacatgggt tcggccttct cgcaaggcag tgcggcaccc      3840
     aacggcaacg ggtctccggt cgaccagtcc atcaacttca acgccccagt aggtacggga      3900
     gtggatcagg cgatgcagaa agcccagtcc gcgcagaacc agcagtaccg ccgcaacaac      3960
     ggcacacgga cgatgccgag ctga                                             3984
//

If you have problems or comments...

PBIL Back to PBIL home page