(data stored in ACNUC30630 zone)

EMBL: CU458896.PE246

CU458896.PE246       Location/Qualifiers
FT   CDS_pept        251779..252003
FT                   /transl_table=11
FT                   /locus_tag="MAB_0249"
FT                   /product="Conserved hypothetical protein"
FT                   /note="Similar to Q27FR9_MYCFV 5e-08"
FT                   /db_xref="EnsemblGenomes-Gn:MAB_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAM60349"
FT                   /db_xref="UniProtKB/TrEMBL:B1MFE9"
FT                   /protein_id="CAM60349.1"
FT                   /translation="MRKLLATVGVAAVLAAGSVALAGPASAAPCGKVVVWGNGGGVCES
FT                   DYAPDGSFTRCDTVYVLGIGGTNCYRVYP"
     atgcggaaac ttctagccac tgtgggtgtc gctgcggttc tggcagctgg aagcgtcgcg        60
     ttggccgggc cagcttcggc ggcaccgtgc ggcaaggtcg tggtgtgggg aaacgggggc       120
     ggggtctgcg agtccgacta cgcgcccgac ggcagcttta cccgctgcga caccgtgtac       180
     gtgctgggta tcggcggcac gaactgctac cgggtgtacc cgtaa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page